SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017030 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017030
Domain Number 1 Region: 18-296
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 8.06e-58
Family FMN-linked oxidoreductases 0.00035
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000017030
Domain Number - Region: 385-435
Classification Level Classification E-value
Superfamily RING/U-box 0.0424
Family RING finger domain, C3HC4 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017030   Gene: ENSNLEG00000014021   Transcript: ENSNLET00000017890
Sequence length 474
Comment pep:novel supercontig:Nleu1.0:GL397368.1:768834:776265:-1 gene:ENSNLEG00000014021 transcript:ENSNLET00000017890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKLQGFEFWSRTLRGARHVVAPMVDQSELAWRLLSRRHGAQLCYTPMLHAQVFVRDANY
RKENLYCEVCPEDRPLIVQFCANDPEVFVQAALLAQDYCDAIDLNLGCPQMIAKRGHYGA
FLQDEWDLLQRMSELAGPSRGTHGHCPLRWGSGEDRPASLLEGGGCELLTVHGRTKEQKG
PLSGAASWEHIKAVRKAVAIPVFANGNIQCLQDVERCLQDTGVQGVMSAEGNLHNPALFE
GRSPAVWELAEEYLDIVREHPCPLSYVRAHLFKLWHHTLQVHQELREELAKVKTLEGIAA
VSQELKLRCQAGAGAEISRQEGAKPTGDLPFHWICQPYIRPGPREGSKEKAGARSKRALE
EEECGTEVLSKNKQKKQLRNPHKTFDPSLKPKYAKCDQCGNPKGNRCVFSLCRGCCKKRA
SKETADCPGHGLLFKTKLEKSLAWKEAQPELQEPQPAAPGTPGGFSEVMSSALA
Download sequence
Identical sequences ENSNLEP00000017030 ENSNLEP00000017030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]