SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017088 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017088
Domain Number 1 Region: 36-124
Classification Level Classification E-value
Superfamily PH domain-like 4.79e-20
Family Third domain of FERM 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000017088
Domain Number - Region: 2-35
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00293
Family Second domain of FERM 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017088   Gene: ENSNLEG00000014072   Transcript: ENSNLET00000017949
Sequence length 147
Comment pep:novel supercontig:Nleu1.0:GL397261.1:545226:554324:-1 gene:ENSNLEG00000014072 transcript:ENSNLET00000017949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLAARILEAHQNVAQMPLVEAKLRFIQAWQSLPEFGLTYYLVRFKGSKKDDILGVSYNRL
IKIDAATGIPVTTWRFTNIKQWNVNWETRQVVIEFDQNVFTAFTCQSADCKIVHEYIGGY
IFLSTRSKDQNETLDEDLFHKLTGGQD
Download sequence
Identical sequences ENSNLEP00000017088 ENSNLEP00000017088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]