SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017097 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017097
Domain Number 1 Region: 379-456
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000138
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 2 Region: 271-322
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000236
Family Second domain of FERM 0.011
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000017097
Domain Number - Region: 25-89
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000719
Family Ubiquitin-related 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017097   Gene: ENSNLEG00000014073   Transcript: ENSNLET00000017958
Sequence length 492
Comment pep:novel supercontig:Nleu1.0:GL397261.1:557417:589459:-1 gene:ENSNLEG00000014073 transcript:ENSNLET00000017958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSSTDFTSASWELVVRVDHPNEEQQKDVTLRVSGDLHVGGVMLKLVEQINISQDWSDFA
LWWEQKHCWLLKTHWTLDKYGVQADAKLLFTPQHKMLRLRLPNLKMVRLRVSFSAVVFKA
VSDICKTLNIRRSEELSLLKPSGDYFKKKKKKDKNNKEPIIEDILNLESSPTASGSSVSP
GLYSKTMTPIYDPINGTPASSTMTWFSDSPLAEQNCSILAFSQPPQSPEALADMYQPRSL
VDKAKLNAGWLDSSRSLMEQGIQEDEQLLLRFKYYSFFDLNPKYDAVRINQLYEQARWAV
LLEEIDCTEEEMLIFAALQYHISKLSLSAETQDFTSESEVDEIEAALSNLEVTLEGGKAD
SLLEDITDIPKLADNLKLFRPKKLLLKAFRYWFVFKDTSIAYFKIQLEQGEPVEKLNLRG
CEVVPDVNVAGRKFGIKLLIPVADGMNEMYLRCDHVSKTPKMLSHFTSTKPKSKTKCFHK
FRALLCQSAIAL
Download sequence
Identical sequences ENSNLEP00000017097 ENSNLEP00000017097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]