SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017252 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017252
Domain Number 1 Region: 22-146
Classification Level Classification E-value
Superfamily Lysozyme-like 1.3e-46
Family C-type lysozyme 0.0000233
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017252   Gene: ENSNLEG00000014207   Transcript: ENSNLET00000018117
Sequence length 148
Comment pep:novel supercontig:Nleu1.0:GL397538.1:651225:656140:-1 gene:ENSNLEG00000014207 transcript:ENSNLET00000018117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKVLLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNIS
KINENADGSFDYGLFQINSHYWCNDYKSYSANLCHVDCQDLLNPNLLAGIHCAKRIVSSA
RGMNNWVEWRLHCSGRPLSYWLTGCRLR
Download sequence
Identical sequences G1RVH5
ENSNLEP00000017252 XP_003281426.1.23891 XP_003281427.1.23891 ENSNLEP00000017252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]