SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017346 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017346
Domain Number 1 Region: 80-293
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.23e-59
Family DBL homology domain (DH-domain) 0.0000215
Further Details:      
 
Domain Number 2 Region: 278-402
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-33
Family Pleckstrin-homology domain (PH domain) 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017346   Gene: ENSNLEG00000014274   Transcript: ENSNLET00000018212
Sequence length 1189
Comment pep:novel supercontig:Nleu1.0:GL397312.1:15704561:15723982:1 gene:ENSNLEG00000014274 transcript:ENSNLET00000018212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVSTSLHQDGSQERPVSLTSTTSSSGSSRDSRSAMEEPSGSEPPAENGAGSPRGRHLPS
SNNNSSSWLNVKGPLSPFNSRAVAGPAHHKLSYLGRVVREIVETERLYVQDLRSIVEDYL
LKIIDTPGLLKPEQVSALFGNIENIYALNSQLLRDLDSCNSDPVAVASCFVERSQEFDIY
TQYCNNYPNSVAALTECMRDKQQAKFFRDRQELLQHSLPLGSYLLKPVQRILKYHLLLQE
IAKHFDEEEDGFEVVEDAIDTMTCVAWYINDMKRRHEHAVRLQEIQSLLINWKGPDLTTY
GELVLEGTFRVHRVRNERTFFLFDKTLLITKKRGDHFVYKGNIPCSSLMLIESTRDSLCF
TVTHYKHSKQQYSIQAKTVEEKRNWTHHIKRLILENHHATIPQKAKEAILEMDSYYPNRY
RYSPERLKKAWSSQDEVSSHVRQGRRQSEPTKHLLRQLNEKARAAGMKGKGRRESESSRS
SRRPSGRSPTGTEKRLSFESISSLPEVSDQQVMGIVGRTWESRFSSLQIGLSGIGSPTGP
MGTEIPHLPGLSALHEAGLEYMILIALAPKLQASVIAERFVSSFSRRSSVAQEDSKSSGF
GSPRLVSRSSSVLSLEGSEKGLARHGSATDSFSCQLSPEVDISVGVATENSPSVNGMEPP
SPGCPVEPDWSSCKKESALSTRDRLLLDKIKNYYENAEHHDAGFSVRRRESLSYIPKGLV
RNSVSRFNSLPRPDPEPVPPVGRKRQVGSRPTSWALFELPGPSHAGKGDPPPISDAEFRP
SSEIVKIWEGMESSGGSPGKGPGQGQANGFDLHEPLFILEEHELGAITEESATASPESSS
PTEGRSPAHLARELKELVKELSSSTQGELVAPLHPRIVQLSHVMDSHVSERVKNKVYQLA
RQYSLRIKSNKPVMARPPLQWEKAAPERDGKSPTVPCLQEEAGEPLGGKGKRKPVLSLFD
YEQLMAQEHSPPKPSSAGEMSPQRFSFNPSAVSQRITSPGGRPSARSPLSPTETFSWPDV
RELCSKYASRDEARRAGGGRPRGPPVNRSHSVPENMVEPPLSGRVGRCRSLSTKRGRGGG
EAARSPGPLPQSKPDGGETLYVTADLTLEDNRRVIVMEKGPPPSPTAGLEESNGQGPSSP
VALLGQVQDFQQSAECQPKEEGPRDSADLSQQGRVRNLREKFQALNSVG
Download sequence
Identical sequences ENSNLEP00000017346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]