SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017399 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017399
Domain Number 1 Region: 403-546
Classification Level Classification E-value
Superfamily PH domain-like 2.71e-40
Family Third domain of FERM 0.0000101
Further Details:      
 
Domain Number 2 Region: 299-404
Classification Level Classification E-value
Superfamily Second domain of FERM 4.19e-34
Family Second domain of FERM 0.00000447
Further Details:      
 
Domain Number 3 Region: 219-298
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.33e-26
Family First domain of FERM 0.000084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017399   Gene: ENSNLEG00000014314   Transcript: ENSNLET00000018266
Sequence length 1005
Comment pep:novel supercontig:Nleu1.0:GL397266.1:22608926:22731107:-1 gene:ENSNLEG00000014314 transcript:ENSNLET00000018266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEVGSASEVKKDSSQLGTDATKEKPKEVAENQQNQSSDPEEEKGSQPSPAAESQSSLR
RRKREKETSESRGISRFIPPWLKKQKSYTLVVAKDGGDKKEPTQAVVEEQVLDKEEPLPE
EQRQAKGDAEEMAQKKQEIKVEVKEEKPSVSKVETQNLIFLPQQPTELVSKEREEKVKET
PEDKLEGGAAKRETKEVQTNELKAEKASQKVAKKTKTVQCKVTLLDGTEYSCDLEKHAKG
QVLFDKVCEHLNLLEKDYFGLLFQESPEQKNWLDPAKEIKRQLRNLPWLFAFNVKFYPPD
PSQLTEDITRYFLCLQLRQDIASGRLPCSFVTHALLGSYTLQAELGDYDPEEHGSIDLSE
FQFAPTQTKELEEKVAELHKTHRGLSPAQADSQFLENAKRLSMYGVDLHHAKDSEGVDIK
LGVCANGLLIYKDRLRINRFAWPKILKISYKRSNFYIKVRPAELEQFESTIGFKLPNHRA
AKRLWKVCVEHHTFYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQASTLIDRPAPHFE
RTSSKRVSRSLDGAPIGDVDQSLMKDFPGTAGEISAYGPGVVSIAVVQGGDGRREVRSPT
KAPHLQLIEGKKNSLRVEGDNIYVRHSNLMLEELDKAQEDILKHQASISELKRNFMESTP
EPRPNEWEKRRITPLSLQTQGSSHETLNIVEEKKRAEVGKDERVITEEMNGKEISPGSGP
GAIRKVEPVTQKDSTSLSSESSSSSSESEEEDVGEYRPHHRVTEGTIREEQEYEEEVEEE
PCLAAKVVEREEAVPEASPVTQAGASVITVETVIQENVGAQKIPGEKSVHEGALKQDMGE
EAEEEPQKVNGEVSHVDIDVLPQIICCSEPPVVKTEMVTISDASQRTEISTKEVPIVQTE
TKTITYESPQIDGGAGGDSGTLLTAQTITSESVSTTTTTHITKTVKGGISETRIEKRIVI
TGDGDIDHDQALAQAIREAREQHPDMSVTRVVVHKETELAEEGED
Download sequence
Identical sequences ENSNLEP00000017399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]