SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017416 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017416
Domain Number 1 Region: 1262-1376
Classification Level Classification E-value
Superfamily PH domain-like 4.76e-34
Family Pleckstrin-homology domain (PH domain) 0.00097
Further Details:      
 
Domain Number 2 Region: 1065-1243
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.76e-19
Family DBL homology domain (DH-domain) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017416   Gene: ENSNLEG00000014282   Transcript: ENSNLET00000018285
Sequence length 1517
Comment pep:novel supercontig:Nleu1.0:GL397280.1:296445:315927:1 gene:ENSNLEG00000014282 transcript:ENSNLET00000018285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPEPVEDCVQSTLAALYPPFEATAPTLLGQVFQVVERTYREDALRYTLDFLVPAKHLLA
KVQQEACAQYSGFLFFHEGWPLCLHEQVVVQLAALPWQLLRPGDFYLQVVPSAAQAPRLA
LKCLAPGGGRVQEIPVPSEACAYLFTPEWLQGINKDRPTGRLSTCLVSAPSGIQRLPWAE
LICPRFVHKEGLMVGHQPSTLPPELPSGPPGLPSPPLPEEALGTRSPGDGHNAPVEGPEG
EYVELLEVTLPVRGSPADAEGSPGLSRVRTVPTRKGAGGKGRHRRHRAWMHQKGLGPRDQ
DGARPPGEGSSTGASPESPPGAEAVPEAAVLEVSEPPAETVGEASESCPLRPGELRGGGG
GQGAEGPPGTPRRTGFLNLNKKRAAGRGAFSRGGDSAPLSPGDKEEASHQEAFGNLLSPT
EHTLPECSLVKEEYEGSGKPESEPKELKTAGKKEPQPSEACGPAEEGPERELEEPDLLCL
AVHAGPEGLLSDTPTPPLETVQEGKGDNIPEEALPVSVSDHPDVAWDLMASGFLILTGGV
DQSGRALLTITPPCPPEEPPPSRDTLNTTLHYLHSLLRPDLQILGLSVLLDLRQAPPLPP
ALIPVLSQLQDSGDPPLVQRLLILIHDDLPTELCGFQGAEVLSENDLKRVAKPEELQWEL
GGHRDPSPSHWVEIHQEVVRLCRLCQGVLGSVRQAIEELEGAAEPEEEEAVGMPKPLQKV
LADPRLTALQRDGGAILMRLRSTHSSKLEGQGPATLYQEVDEAIHQLVRLSNLHVQQQEQ
RQCLRRLQQVLQWLSGPGEEQLASFAMPGDTLSALQETELRFRAFSAEVQERLAQARGAL
ALEENATSQKVLDIFEQRLEQVESGLHRALRLQRFFQQAHEWVDEGFARLAGAGPGREAV
LAALALRRAPEPSAGTFQEMRALALDLGSPAALREWGHCRARCQELERRIQQQLGEEASP
RGYRRRRADSASSGGAQWGPHSPSPSLSSLLLPSSPGPRPAPSHCSLAPCGEDYEEEGPE
LAPEAEGRPPRAVLIRGLEVTSTEVVDRTCSPREHVLLGRAGGPDGPWGVGTPRMERKRS
ISAQQRLVSELIACEQDYVATLSEPVPPPGPELTPELRGTWAAALSARERLRSFHRTHFL
RELQGCATHPLRIGACFLRHGDQFSLYAQYVKHRHKLENGLAALSPSSKGSMEAGPYLPR
ALQQPLEQLARYGRLLEELLREAGPELSSERQALGAAVQLLREQEARGRDLLAVEAVRGC
EIDLKEQGQLLHRDPFTVICGRKKCLRHVFLFEHLLLFSKLKGPEGGSEMFVYKQAFKTA
DMGLTENIGDSGLCFELWFRRRRAREAYTLQATSPEIKLKWTSSIAQLLWRQAAHNKELR
VQQMVSMGIGNKPFLDIKALGERTLSALLTGRAARTRASVAVSSFEHAGPSLPGLSPGAC
SLPARVEEEAWDLDVKQISLAPETLDSSGDVSPGPRNSPSLQPPNPGSSTPTLASRGILG
LSRQSHARALSDPTTPL
Download sequence
Identical sequences ENSNLEP00000017416 ENSNLEP00000017416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]