SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017431 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017431
Domain Number 1 Region: 49-294
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.82e-76
Family Pseudouridine synthase II TruB 0.00000286
Further Details:      
 
Domain Number 2 Region: 296-377
Classification Level Classification E-value
Superfamily PUA domain-like 1.22e-20
Family PUA domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017431   Gene: ENSNLEG00000014323   Transcript: ENSNLET00000018300
Sequence length 514
Comment pep:novel supercontig:Nleu1.0:GL397458.1:1169677:1183547:1 gene:ENSNLEG00000014323 transcript:ENSNLET00000018300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADAEVIILPKKHKKKKERKSLPEEDVAEIQHAEEFLIKPESKVAKLDTSQWPLLLKNFD
KLNVRTTHYTPLACGSNPLKREIGDYIRTGFINLDKPSNPSSHEVVAWIRRILRVEKTGH
SGTLDPKVTGCLIVCIERATRLVKSQQSAGKEYVGIVRLHNAIEGGTQLSRALETLTGAL
FQRPPLIAAVKRQLRVRTIYESKMIEYDPERRLGIFWVSCEAGTYIRTLCVHLGLLLGVG
GQMQELRRVRSGVMSEKDHMVTMHDVLDAQWLYDNHKDESYLRRVVYPLEKLLTSHKRLV
MKDSAVNAICYGAKIMLPGVLRYEDGIEVNQEIVVITTKGEAICMAIALMTTAVISTCDH
GIVAKIKRVIMERDTYPRKWGLGPKASQKKLMIKQGLLDKHGKPTDSTPATWKQEYVDYS
ESAKKEVVAEVVKAPQVVAEAAKTAKRKRDSESESDETPPAAPQLIKKEKKKSKKDKKAK
AGLESGAEPGDGDSDTKKKKKKKKKAKEVELVSE
Download sequence
Identical sequences G1RW04
ENSNLEP00000017431 XP_003279372.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]