SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017441 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017441
Domain Number 1 Region: 537-733
Classification Level Classification E-value
Superfamily PUA domain-like 7.95e-42
Family LON domain-like 0.007
Further Details:      
 
Domain Number 2 Region: 202-298
Classification Level Classification E-value
Superfamily TPR-like 1.18e-16
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 
Domain Number 3 Region: 445-498
Classification Level Classification E-value
Superfamily RING/U-box 6.24e-16
Family RING finger domain, C3HC4 0.008
Further Details:      
 
Domain Number 4 Region: 137-169
Classification Level Classification E-value
Superfamily RING/U-box 0.00000287
Family RING finger domain, C3HC4 0.02
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000017441
Domain Number - Region: 26-98
Classification Level Classification E-value
Superfamily TPR-like 0.000625
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017441   Gene: ENSNLEG00000014343   Transcript: ENSNLET00000018310
Sequence length 754
Comment pep:novel supercontig:Nleu1.0:GL397368.1:2000796:2041092:-1 gene:ENSNLEG00000014343 transcript:ENSNLET00000018310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPEPVPPPPPPQCPGCDRAEPIAQRLEEGDEAFRAGEYEMAAELFRSMLAGLAQPDRGL
CLRLGDALARAGRLPEALGAFRGAARLGALRPEELEELAGGLVRAVGLRERPLSAENPGG
EPEAPGEGGPAPEPRAPRDLLGCPRCRRLLHKPVTLPCGLTVCKRCVEPGPARPQARRVN
VVLSGLLEKCFPAECRLRRLAGQARSLQRQQQPEAALLRCDQALELAPDDNSLLLLRAEL
YLTMKNYEQALQDASVACQNEPLLIKGHQVKAQALSGLGRSKEVLKEFLYCLALNPECNS
VKKEAQKVMCEVLFSATENVHENLTSSIQSRLKAQGHSHMNAQALLEEGDAGSSENASEK
SDMLGNTSSSVLYFILGLHFEEDKKALESILPTAPSAGLKRQFPDDVEDAPDLNAPGKIP
KKDLSPQRSPNSETEESQGLSLDVTDFECALCMRLLFEPVTTPCGHTFCLKCLERCLDHA
PHCPLCKDKLSELLASRNFNITVLAEELIFRYLPDELSDRKRIYDEEMSELSNLTRDVPI
FVCAMAFPTVPCPLHVFEPRYRLMIRRCMETGTKRFGMCLSAEHAGLSEYGCMLEIKDVR
TFPDGSSVVDAIGISRFRVLSHRHRDGYNTADIEYLEDEKVEGPEYEELAALHDSVHQQS
VSWFASLQDRMKEQILSHFGVMPDREPEPQSNPSGPAWSWWILAVLPLERKAQLAILGMT
SLKERLLAIRRILVIITRKMNSRQELANARERNN
Download sequence
Identical sequences G1RW14
XP_003274896.1.23891 ENSNLEP00000017441 ENSNLEP00000017441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]