SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017521 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017521
Domain Number 1 Region: 96-304
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.37e-55
Family DBL homology domain (DH-domain) 0.0000413
Further Details:      
 
Domain Number 2 Region: 289-417
Classification Level Classification E-value
Superfamily PH domain-like 3.75e-25
Family Pleckstrin-homology domain (PH domain) 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017521   Gene: ENSNLEG00000014390   Transcript: ENSNLET00000018395
Sequence length 1386
Comment pep:novel supercontig:Nleu1.0:GL397330.1:2211861:2224158:-1 gene:ENSNLEG00000014390 transcript:ENSNLET00000018395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGAQGLSLSKPSLSLGCGRRGEVCDCGTVCETRTAPAAPTMASPRGSGSSTSLSTVGS
EGDPAPGPTPACSASRPEPLPGPPIRLHLSPVGIPGSAKPSRLERVAREIVETERAYVRD
LRSIVEDYLGPLLDGGVLGLSVEQVGTLFANIEDIYEFSSELLEDLENSSSAGGIAECFV
QRSEDFDIYTLYCMNYPSSLALLRELSLSPPAALWLQERQAQLRHSLPLQSFLLKPVQRI
LKYHLLLQELGKHWAEGPGTGGREMVEEAIVSMTAVAWYINDMKRKQEHAARLQEVQRRL
GGWTGPELSAFGELVLEGAFRGGGGGGPRLRGGERLLFLFSRMLLVAKRRGLEYTYKGHI
FCCNLSVSESPRDPLGFKVSDLTIPKHRHLLQAKNQEEKRLWIHCLQRLFFENHPASIPA
KAKQVLLENSLHCAPKSKPVPEPLTPPLGSPRPRDARSFTPGRRNTAPSPGPSVIRRGRR
QSEPVKDPYVMFPQNAKPGFKHAGSEGELYPPESQPPVSGSGPPEDLEDAGPPTLDPSGP
SITEEILELLNQRGLRDPGPSTHDIPKFPGDSQVPRDSETLTFQALPSRDSSEEEEEEEE
GLEMDERGPSPLHVLEGLESSIAAEMPSIPCLTKIADVPNLPEIPSHCEIPEGSRIPSLP
DISDVFEMPCLPAIPSVPDAPSLSSTPTLSCDSWLQGPLQEPAEAPATRRELFSGSNPGK
LGEPPSGGKAGPEEDEEGVSFTDFQLQDVTQHQGFPDELAFRSCSEIRSAWQALEQGQLA
RPGFPEPLLILEDSDLGGDSGSRKAGAPSSERTASRVRELARLYSERIQQMQRAETRASA
NAPRRRPRVLAQPQPSPCLPQEQAEPGLLPAFGHVLVCELAFPLTCAQESVPLGPAAWVQ
AAIPLSKQGGSPDGQGLHVSNLPKQDHPGIHVSAATLLPEQGGSRHVQAPAATPLPKQEG
PLHLQVPALTTLPDQGHPEIQVPATTPLPEYRSHVAKPAPSTAFCPEQGHCGDIHVPTTP
TLPKEICSDFTVSVTTPVPKQEGHLDSESPTNIPLTKQGGSRDVQGPDPVCSQPIQPLSL
HGSSLDPQSPGDTLPPLPCHLPDLQIPGSSPLPAHGSHLDHRIPANAPLSLSQGLPDTQI
PATTPLPLPQVLTDIWVQALPTSPRQGSLPDIQGPAAAPPLPEPSLTDTQVQKLTPLLEQ
KSLTDAHVPAATPLPERGGSLDIQGLLPTPVQTTMVLSKPGGSLASHIARLESSDLTPPH
SPPPSSRQLLGPNAAALSRYLAASYISQSLARRQGPGGGAPAASRGSWSSAPTSRASSPP
PQPQPPPPPARRLSYATTVNIHVGGGGRLRPAKAQVRLNHPALLASTQEFVGLPRAQGAP
DAPFHM
Download sequence
Identical sequences G1RW94
XP_003270423.1.23891 ENSNLEP00000017521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]