SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017522 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017522
Domain Number 1 Region: 255-475
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-54
Family DBL homology domain (DH-domain) 0.0000839
Further Details:      
 
Domain Number 2 Region: 608-674
Classification Level Classification E-value
Superfamily SH3-domain 5.38e-17
Family SH3-domain 0.0014
Further Details:      
 
Domain Number 3 Region: 466-595
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000389
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017522   Gene: ENSNLEG00000014408   Transcript: ENSNLET00000018396
Sequence length 710
Comment pep:novel supercontig:Nleu1.0:GL397366.1:6190100:6327180:-1 gene:ENSNLEG00000014408 transcript:ENSNLET00000018396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METTESEDLEKTWRKSASDQPNIDNEPAKVKPELLPEKEETSQADQDIQDQEPHCHIPIK
RNSIFNRSIRRRSKAKARDSPEWNASCLADSQDNGKSVNEPLTLNIPWSRMPPCRTAMQT
GPGAQKMSESSSTPGNGATPEEWPALADSPTTLTEALRMIHPIPADSWRNLIEQIGLLYQ
EYRDKSTLQEIETRRQQDAEIQDNTNGSPASEDTPEEEEEEEEEEEEPASPPERKALPQI
CLLSNPHSRFNLWQDLPEIRSSGVLEILQPEEIKLQEAMFELVTSEASYYKSLNLLVSHF
MENERIKKILHPSEAHILFSNVLDVLAVSERFLLELEHRMEENIVISDVCDIVYRYAADH
FSVYITYVSNQTYQERTYKQLLQEKAAFRELIAQLELDPKCRGLPFSSFLILPFQRITRL
KLLVQNILKRVEERSERECTALDAHKELEMVVKACNEGVRKMSRTEQMISIQKKMEFKIK
SVPIFSHSRWLLKQGELQQMSGPKTSRTLRTKKLFHEIYLFLFNDLLVICRQIPGDKYQV
FDSAPRGLLRVEELEDQGQTLANVFILRLLENADDREATYMLKASSQAQLRAWWERAGVV
RWWGRARASCPSDCPQVQCVHPYVAQQPDELTLELADILNILDKTDDGWIFGERLHDQER
GWFPSSMTEEILNPKIRSQNLKECFRVHKMDDPQRSQNKDRRKLGSRNRQ
Download sequence
Identical sequences ENSNLEP00000017522 ENSNLEP00000017522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]