SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017530 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017530
Domain Number 1 Region: 882-1183
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.36e-90
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000123
Further Details:      
 
Domain Number 2 Region: 216-356
Classification Level Classification E-value
Superfamily PH domain-like 2.09e-26
Family Third domain of FERM 0.01
Further Details:      
 
Domain Number 3 Region: 105-199
Classification Level Classification E-value
Superfamily Second domain of FERM 4.45e-22
Family Second domain of FERM 0.00089
Further Details:      
 
Domain Number 4 Region: 18-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.37e-20
Family First domain of FERM 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017530   Gene: ENSNLEG00000014407   Transcript: ENSNLET00000018405
Sequence length 1187
Comment pep:novel supercontig:Nleu1.0:GL397299.1:8699635:8812452:1 gene:ENSNLEG00000014407 transcript:ENSNLET00000018405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFGLKLRRTRRYNVLSKNCFVTRIRLLDSNVIECTLSVESTGQECLEAVAQRLELRETH
YFGLWFLSKSQQARWVELEKPLKKHLDKFANEPLLFFGVMFYVPNVSWLQQEATRYQYYL
QVKKDVLEGRLRCTLDQVIRLAGLAVQADFGDYNQFDSQDFLREYVLFPMDLALEEAVLE
ELTQKVAQEHKGHSNSGLEPTHFYFFHHMTQLLNMGHHKYLLLDNHGNCVHLGIFFMGIF
VRNRIGRQAVIYRWNDMGNITHNKSTILVELINKEETALFHTDDIENAKYISRLFATRHK
FYKQNKICTEQSNSPPPIRRQPTWSRSSLPRQQPYILPPVHVQCGEHYSETHTSQDSIFH
GNEEALYCNSHNSLDLNYLNGTVTNGSVCSVHSVNSLNCSQSFIQASPVSSNLSIPGSDI
MRADYIPSHRHSAIIVPSYRPTPDYETVMRQMKRGILHTDSQSQSLRNLNIINTHAYNQP
EDLVYSQPEMRERHPYTVPYGPQGVYSNKLVSPSDQRNPKNNVVPSKPGASAISHTVSTP
ELANMQLQGSHNYSTAHMLKNYLFRPPPPYPRPRPATSTPDLASHRHKYVSGSSPDLVTR
KVQLSVKTFQEDSSPVVHQSLQEVSEPLTATKHHGTVNKRHSLEVMNSMVRGMEAMTLKS
LHLPMARRNTLREQGPPEEGSGSHEVPQLPQYHHKKTFSDATMLIHSSESEEEEEEAPES
VPQIPMLREKMEYSAQLQAALARIPNKPPPEYPGPRKSVSNGALRQDQASLPSAMARARV
LRHGPAKAISVSRTDPPAVNGASLGPSISEPDLTSVKERVKKEPVKERPVSEMFSLEDSI
IEREMMIRNLEKQKMAGLEAQKRPLMLAALNGLSVARVSGREDNRVDATRVPMDERFRTL
KKKLEEGMVFTEYEQIPKKKANGIFSTAALPENAERSRIREVVPYEENRVELIPTKENNT
GYINASHIKVVVGGAEWHYIATQGPLPHTCHDFWQMVWEQGVNVIAMVTAEEEGGRTKSH
RYWPKLGSKHSSATYGKFKVTTKFRTDSVCYATTGLKVKHLLSGQERTVWHLQYTDWPDH
GCPEDVQGFLSYLEEIQSVRRHTNSMLEGTKNRHPPIVVHCSAGVGRTGVLILSELMIYC
LEHNEKVEVPMMLRLLREQRMFMIQTIAQYKFVYQVLIQFLQNSRLI
Download sequence
Identical sequences ENSNLEP00000017530 ENSNLEP00000017530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]