SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017878 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017878
Domain Number 1 Region: 157-283
Classification Level Classification E-value
Superfamily RNI-like 0.000000000000647
Family 28-residue LRR 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017878   Gene: ENSNLEG00000014700   Transcript: ENSNLET00000018770
Sequence length 343
Comment pep:novel supercontig:Nleu1.0:GL397288.1:4078713:4131040:1 gene:ENSNLEG00000014700 transcript:ENSNLET00000018770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTRQTKGSLAERASPGAAPGPRRERPDFWASLLLRAGDKRGARVRGCPPYHRRVGMVQE
LLRMVRQGRREEAGTLLQYLRQDLGMESTSLDDVLYRYASFRNLVDPITHDLIISLARYI
HCPKPEGDALGAMEKLCRQLTYHLSPHSQWRRHRGLVKRKPQACLKAVLAGSPPDNTVDL
SGIPLTSRDLERVTSYLQRCGEQVDSVELGFTGLTDDMVLQLLPALSTLPRLTTLALNGN
RLTRAVLRDLTDILKDPSKFPNVTWIDLGNNVDIFSLPQPFLLSLRKRSPKQGHLPTILE
LGEGPGSGEEVREGTVGQDPGGGPVAPAEDHHEGKETVAAAQT
Download sequence
Identical sequences A0A2I3GRS3
ENSNLEP00000017878 XP_003262660.1.23891 ENSNLEP00000017878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]