SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017893 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017893
Domain Number 1 Region: 773-971
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.67e-47
Family DBL homology domain (DH-domain) 0.00015
Further Details:      
 
Domain Number 2 Region: 1035-1232
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.77e-45
Family BAR domain 0.0026
Further Details:      
 
Domain Number 3 Region: 244-310
Classification Level Classification E-value
Superfamily SH3-domain 1.16e-17
Family SH3-domain 0.00095
Further Details:      
 
Domain Number 4 Region: 1530-1597
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-17
Family SH3-domain 0.0000162
Further Details:      
 
Domain Number 5 Region: 142-204
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000131
Family SH3-domain 0.0009
Further Details:      
 
Domain Number 6 Region: 1300-1377
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000197
Family SH3-domain 0.00000745
Further Details:      
 
Domain Number 7 Region: 4-62
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000801
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 8 Region: 69-134
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000113
Family SH3-domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017893   Gene: ENSNLEG00000014697   Transcript: ENSNLET00000018785
Sequence length 1600
Comment pep:novel supercontig:Nleu1.0:GL397265.1:33419250:33516180:-1 gene:ENSNLEG00000014697 transcript:ENSNLET00000018785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAGSVVRAIFDFCPSVSEELPLFVGDVIEVLAVVDEFWLLGKKEDVTGQFPSSFVEIVT
IPSLKEGERLFVCICEFTSQELDNLPLHRGDLVILDGIPTAGWLQGRSCWGARGFFPSSC
VRELCLSSQSRQWHSQSALFQIPAYSMGQARALMGLSAQLDEELDFREGDVITIIGVPEP
GWFEGELEGRRGIFPEGFVELLGPLRTVDESVSSGNQDDCMVNGEVDTPVGEEEIGPDED
EEEPGTYGVALYRFQALEPNELDFEVGDKIRILATLEDGWLEGSLKGRTGIFPYRFVKLC
PDTRVEETMALPQEGSLARIPETSLDCLENSLEVEEQRHETSDHETEEPDCIISEAPTSP
LGHLTSEYDADRNSYHDEDTTGGPPRSPGVEWEMPLATDSPTSDPSEVVSVTSSQPQVPF
HPNLQKSQYYSTAGGSHLHSEQYPDLPLEARTRDYASLPPKRMYSQLKTLQKPVLPLYRG
SSVSASRVVKPSQSSPQLHNLASYAKKHHMSSVYSVSERLEMKPGPQAQGLVTEAATHSQ
GDGSTDLDSKLTQQLIEFEKSLAAPGTEPDKILRHFSIMDFNSEKDIVRGSSKLITEQEL
PERRKALRPPPPRPYTPVSTSPHLLVDQNLKPAPPLVVRPSRPAPLPPSAQQRTNAVSPK
LLSRHRPTCETLEKEGPGHMGKSLDQTSPCPLVLVRIEEMEQDLDMYSRAQEELNLMLEE
KQDESSRAETLEDLKFCESNIESLNMELQQLREMTLLSSQSSSLVAPSGSVSTENPEQRM
LEKRAKVIEELLQTERDYIRDLEMCIERIMVPLQQAQVPNFDFEGLFGNMQMVIKVSKQL
LAALEISDAVGPVFLGHRDELEGTYKVYCQNHDEAIALLEIYEKDEKIQKHLQDSLADLK
SLYNEWGCTNYINLGSFLIKPVQRVMRYPLLLMELLNSTPESHPDKVPLTNAVLAVKEIN
VNINEYKRRKDLGKNSIIAKKEYVHAEESAFLTYSLVLKYRKGDEDSLMEKISKLNIHSI
IKKSNRVSSHLKHLTGFAPQIKDEVFEETEKNFRMQERLIKSFIRDLSLYLQHIRESACV
KVVAAVSMWDVCMERGHRDLEQFERVHRYISDQLFTNFKERTERLVISPLNQLLSMFTGP
HKLVQKRFDKLLDFYNCTERAEKLKDKKTLEELQSARNNYEALNAQLLDELPKFHQYAQG
LFANCVHGYAEAHCDFVHQALEQLKPLLSLLKVAGREGNLIAVFHEEHSRVLQQLQVFTF
FPESLPATKKPFERKTIDRQSARKPLLGLPSYMLQSEELRASLLARYAPEKLFQAERNFN
AAQDLDVSLLEGDLVGVIKKKDPMGSQNRWLIDNGVTKGFVYSSFLKPYNPRRSHSDASV
GSHSSTESEHGSSSPRFPRQNSGSTLTFNPSSMAVSFTSGSCQKQPQDASPPPKECDQGT
LSASLNPSNSESSPSRCPSDPDSTSQPRSGDSADVARDVNQPTATPRSYRNFRHPEIVGY
SVPGRNGQSQDLVKGCTRTAQAPEDRSAEPDSSEAEGNQVYFAVYTFKARNPNELSVSAN
QKLKILEFKDVTGNTEWWLAEVNGKKGYVPSNYIRKTEYT
Download sequence
Identical sequences ENSNLEP00000017893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]