SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018034 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018034
Domain Number 1 Region: 369-565
Classification Level Classification E-value
Superfamily PUA domain-like 2.49e-38
Family LON domain-like 0.0091
Further Details:      
 
Domain Number 2 Region: 55-165
Classification Level Classification E-value
Superfamily TPR-like 3.8e-24
Family Tetratricopeptide repeat (TPR) 0.002
Further Details:      
 
Domain Number 3 Region: 277-346
Classification Level Classification E-value
Superfamily RING/U-box 2.7e-17
Family RING finger domain, C3HC4 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018034   Gene: ENSNLEG00000014827   Transcript: ENSNLET00000018930
Sequence length 573
Comment pep:novel supercontig:Nleu1.0:GL397286.1:14704484:14747604:1 gene:ENSNLEG00000014827 transcript:ENSNLET00000018930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XADRRCALCGVKLSALMVATGRARGARRAGQQPPPPPLRVNVVLSGLLGKLFPGPARASQ
LRHEGNRLYRERQVEAALLKYNEAVKLAPNDHLLYSNRSQIYFTLESHENALHDAEIACK
LRPMGFKAHFRKAQALATLGKVEEALREFLYCVSLDGKNKRARCEAQRDNLELPHCSSQE
EAAVRGPSSVMDPAKVKGDGQQHHMKDQEEEEEKRDATSPKAASSKTGKCQEKKRKHCHI
ESQEETGMPNKASKQDPPTDQGDKPALSLPLASFDASDLECALCMRLFYEPVTTPCGHTF
CLKCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRKLYEEEM
EELSNLNKNVPIFVCTIAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLGDPVKGFA
EYGCILEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIEDQKVQGEDCAE
LMGLHNCVYQQASLWFHSLKSSLKNRILNHFGPMPEKDADPQMNPNGPAWCWWMLAVLPL
ESRAQLPFLAMRSLKDRLNGIRRVLAFISRNQN
Download sequence
Identical sequences ENSNLEP00000018034 ENSNLEP00000018034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]