SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018092 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018092
Domain Number 1 Region: 383-600
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-52
Family DBL homology domain (DH-domain) 0.00012
Further Details:      
 
Domain Number 2 Region: 612-688,782-840
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000963
Family Pleckstrin-homology domain (PH domain) 0.032
Further Details:      
 
Domain Number 3 Region: 897-1073
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000208
Family WD40-repeat 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018092   Gene: ENSNLEG00000014871   Transcript: ENSNLET00000018990
Sequence length 1074
Comment pep:novel supercontig:Nleu1.0:GL397337.1:1500748:1589928:1 gene:ENSNLEG00000014871 transcript:ENSNLET00000018990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQREPLPPASAENEMKYDTNNNEEEEGEQFDFDSGDEIPEADRQAPSAPEIGGAGASEA
PAPTGGEDGAGAETTPVVEPTKLVLPMKVNPYSVIDITPFQEDQPPTPVPSTEEENVGLH
VPCGYSVPVPCGYAVPSNLPLLLPAYSSPVIIRATSLDEEETPEVTEDRQPNSLSSEEPP
NSEDQAGREDSALARWAADPANTAWMENPEEAIYDDVPRENSDSEPDEMIYDDVENGDEG
GNSSLEYGWSSSEFESYEEQSDSECKNGIPRSFLRSNHKKQLSHDLTRLKEHYEKKMRDL
MASTVGVVEIQQLRQKHELKMQKLVKAAKDGTKDGLERTRAAVKRGRSFIRTKSLITQDH
RSSLEEEQNLFIDVDCKHPEAILTPMPEGLSQQQVVRRYILGSVVDSEKNYVDALKRILE
QYEKPLSEMEPKVLSERKLKTVFYRVKEILQCHSLFQIALASRVSEWDSVEMIGDVFVAS
FSKSMVLDAYSEYVNNFSTAVAVLKKTCATKPAFLEFLKQEQEASPDRTTLYSLMMKPIQ
RFPQFILLLQDMLKNTSRGHPDRLPLQMALTELETLAEKLNERKRDADQRCEVKQIAKAI
NERYLNKLLSSGSRYLIRSDDMIETVYNDRGEIVKTKERRVFMLNDVLMCATGSSREYGS
SPGTSSQRYLLKWSVPLGHVDAIEYGSSPGTGEHSRHLAVHPPESLAVVANVKPNKVYMG
PGQLYQDLQNLLHDLNVIGQITQLIGSLKGNYQNLNQSVAHDWTSGLQRLILKKEDEIRA
ADCCRIQLQLPGKQDKSGRPTFFTAVFNTFTPAIKESWVNSLQMAKLALEEENHMGWFCV
EDDGNHIKKEKHPLLVGHMPVMVAKQQEFKIECAAYNPEPYLNDESQPDSFSTAHGFLWI
GSCTHQMGQIAIVSFQNSTPKVIECFNVESRILCMLYIPVEEKRREPGAPPDPETPAVRA
SDVPTICVGTEEGSISIYKSNQGSNKVRLQHFFTPEKSKVMILSCTSHSLYAGLVNGAVA
SYARAPDGSWDSEPQKVIKLGVLPVRSLLMMEDMLWAASGGQVFIISVETHAVE
Download sequence
Identical sequences ENSNLEP00000018092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]