SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018337 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018337
Domain Number 1 Region: 274-468
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.28e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.00000000418
Further Details:      
 
Domain Number 2 Region: 24-159
Classification Level Classification E-value
Superfamily SH2 domain 6.06e-27
Family SH2 domain 0.0000000867
Further Details:      
 
Domain Number 3 Region: 204-268
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.53e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000369
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018337   Gene: ENSNLEG00000015081   Transcript: ENSNLET00000019248
Sequence length 468
Comment pep:novel supercontig:Nleu1.0:GL397330.1:9174569:9508086:1 gene:ENSNLEG00000015081 transcript:ENSNLET00000019248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPKRIICPREVENRPKYYGREF
HGIISREQADELLGGVEGAYILRESQRQPGCYTLALRFGNQTLNYRLFHDGKHFVGEKRF
ESIHDLVTDGLITLYIETKAAEYISKMTTNPIYEHIGYATLLREKVSRRLSRSKNEPRKT
NVTHDEHTAVEKISSLVRRAALTHNDNHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIA
QGVRCSDCGLNVHKQCSKHVPNDCQPDLKRIKKVYCCDLTTLVKAHNTQRPMVVDICIRE
IEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISANVYPDINIITGALKLYFRDLP
IPVITYDTYSKFIDAAKISNADERLEAVHEVLMLLPPAHYETLRYLMIHLKKVTMNEKDN
FMNAENLGIVFGPTLMRPPEDSTLTTLHDMRYQKLIVQILIENEDVLF
Download sequence
Identical sequences A0A2I3H2B1
ENSNLEP00000018337 ENSNLEP00000018337 XP_003270516.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]