SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018389 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018389
Domain Number 1 Region: 83-266
Classification Level Classification E-value
Superfamily RNI-like 1.06e-33
Family Cyclin A/CDK2-associated p19, Skp2 0.013
Further Details:      
 
Domain Number 2 Region: 18-56
Classification Level Classification E-value
Superfamily F-box domain 0.00000563
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018389   Gene: ENSNLEG00000015140   Transcript: ENSNLET00000019303
Sequence length 300
Comment pep:novel supercontig:Nleu1.0:GL397265.1:36018667:36021971:1 gene:ENSNLEG00000015140 transcript:ENSNLET00000019303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPMEPSGGEQEPGAVRLLDLPWEDVLLPHVLNRVPLRQLLRLQRVSRAFRALVQLHLA
GLRRFDAAQVGPQIPRAALARLLRDAEGLQELALAPCHEWLSDEDLVPVLARNPQLRSVA
LGGCGQLSRRALGALAEGCPRLQRLSLAHCDWVDGLALRGLADRCPALEELDLTACRQLK
DEAIVYLAQRRGAGLRSLSLAVNANVGDAAVQELARNCPELQHLDLTGCLRVGSDGVRTL
AEYCPALRSLRVRHCHHVAESSLSRLRKRGVDIDVEPPLHQALVLLQDMAGFAPFVNLQV
Download sequence
Identical sequences G1RYR2
ENSNLEP00000018389 ENSNLEP00000018389 XP_003255443.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]