SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018412 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018412
Domain Number 1 Region: 870-1143
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.09e-68
Family Protein kinases, catalytic subunit 0.0000075
Further Details:      
 
Domain Number 2 Region: 562-847
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.46e-47
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 3 Region: 418-543
Classification Level Classification E-value
Superfamily SH2 domain 1.83e-16
Family SH2 domain 0.0022
Further Details:      
 
Domain Number 4 Region: 147-280
Classification Level Classification E-value
Superfamily Second domain of FERM 7.11e-16
Family Second domain of FERM 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000018412
Domain Number - Region: 368-422
Classification Level Classification E-value
Superfamily PH domain-like 0.000209
Family Third domain of FERM 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018412   Gene: ENSNLEG00000015149   Transcript: ENSNLET00000019326
Sequence length 1151
Comment pep:novel supercontig:Nleu1.0:GL397299.1:20531226:20585278:-1 gene:ENSNLEG00000015149 transcript:ENSNLET00000019326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQYLNIKEDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVIFYLSDREPLQLGSGEYTAEEL
CIKAAQACRISPLCHNLFALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKVPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN
WFHSNDSGNVLYYEVMVTGNLGIQWRHKPNVVSVEKEKKLKRKLENKHKKDEEKNKIREE
WNNFSYFPEITHIVKESVVSINKQTTGKWELKLSSHEEALSFVSLVDGYFRLTADAHHYL
CTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVTCFE
KSEQVQGAQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFMLKRC
CQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDLVQGEHLGRGTRTHIYSGTLM
DYKDDEGTSEEKKIKVILKVLDPSHRDISLAXXEAASMMRQVSHKHIVYLYGVCVRDVEN
IMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLLLA
REGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFGTTL
WEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAIMR
DINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGE
QVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGS
LKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFG
LTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSS
PMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSSRTTFQ
NLIEGFEALLK
Download sequence
Identical sequences ENSNLEP00000018412 ENSNLEP00000018412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]