SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018455 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000018455
Domain Number - Region: 125-189
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00136
Family beta-sandwich domain of Sec23/24 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018455   Gene: ENSNLEG00000015205   Transcript: ENSNLET00000019380
Sequence length 363
Comment pep:novel supercontig:Nleu1.0:GL397265.1:36355844:36433834:1 gene:ENSNLEG00000015205 transcript:ENSNLET00000019380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERRRLLGGMALLLLQALPSPLSARAEPPQDKEACVGTNNQSYICDTGHCCGQSQCCNYY
YELWWFWLVWTIIIILSCCCVCHHRRAKHRLQAQQRQHEINLIAYREAHNYSALPFYFRF
LPNYLLPPYEEVVNRPPTPPPPYSAFQLQQQQLLPPQCGPAGGSPPGIDPTRASQGAQSS
PLSGPSRSSTRPPSIADPEPSDLPVDRAATKAPGMETSGSVAGLGELDPGAFLDKDAECR
EELLKDDSSEHGAPDSKEKTPGRHRRFTGDSGIEVCVCNRGHHDDDLKEFNTLIDDALDG
PLDFCDSCHVRPPGDEEEGLCQPSEEQAREPGHPHLPRPPACLLLNTINEQDSPNSQSSS
SPS
Download sequence
Identical sequences A0A2I3FR67
ENSNLEP00000018455 XP_003255458.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]