SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018532 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018532
Domain Number 1 Region: 143-280
Classification Level Classification E-value
Superfamily TNF-like 3.83e-37
Family TNF-like 0.00027
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000018532
Domain Number - Region: 55-64
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00154
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 2-72
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0262
Family beta-sandwich domain of Sec23/24 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018532   Gene: ENSNLEG00000015271   Transcript: ENSNLET00000019460
Sequence length 280
Comment pep:novel supercontig:Nleu1.0:GL397275.1:23055401:23063540:1 gene:ENSNLEG00000015271 transcript:ENSNLET00000019460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPSSVPRRPGQRRPPPPPPPPPLPPPPPP
PLPPLPLPPPKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQR
HTASSLEKQIGHPSPPPEKKELRKVAHLTGKPSSRSMPLEWEDTYGIVLLSGVKYKKGGL
VINETGLYFVYSKVYFRGQSCNNLPLSHKVYLRNSKYPQDLVMMEGKMMSYCTTGQMWAR
SSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Download sequence
Identical sequences G1RZ55
XP_003258938.1.23891 ENSNLEP00000018532 ENSNLEP00000018532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]