SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018559 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018559
Domain Number 1 Region: 781-850
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000109
Family IBR domain 0.0000132
Further Details:      
 
Domain Number 2 Region: 65-166
Classification Level Classification E-value
Superfamily PUG domain-like 0.000000000000445
Family PUG domain 0.0044
Further Details:      
 
Domain Number 3 Region: 698-763
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000565
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 4 Region: 861-933
Classification Level Classification E-value
Superfamily RING/U-box 0.0000102
Family RING finger domain, C3HC4 0.038
Further Details:      
 
Domain Number 5 Region: 352-377
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000589
Family Ran binding protein zinc finger-like 0.0029
Further Details:      
 
Domain Number 6 Region: 574-613
Classification Level Classification E-value
Superfamily UBA-like 0.0000975
Family UBA domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000018559
Domain Number - Region: 302-327
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00157
Family Ran binding protein zinc finger-like 0.0029
Further Details:      
 
Domain Number - Region: 409-434
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00302
Family Ran binding protein zinc finger-like 0.0041
Further Details:      
 
Domain Number - Region: 215-246
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00983
Family TFIIH p44 subunit cysteine-rich domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018559   Gene: ENSNLEG00000015277   Transcript: ENSNLET00000019487
Sequence length 1072
Comment pep:novel supercontig:Nleu1.0:GL397280.1:3283740:3298910:1 gene:ENSNLEG00000015277 transcript:ENSNLET00000019487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGEEEERAFLVAREELASSLRRDSGQAFSLEQLRPLLASSLPLATRYLQLDAARLVRCN
AHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLR
LYGYTEEQPDGLSFPEGQEEPDEHQVATVTLEVLLLRTELSLLLQNTHPRQQALEQLLED
KVEDDMLQLSEFDPLLREIAPGPLTTPSVPGSTPGPCFLCGSAPGTLHCPSCKQALCPAC
DHLFHGHPSRAHHLRQTLPGVLQGTHLSSSLPASAQPRPQSTSLLALGDSSLSSPNPASA
RLPWHCAACAMLNEPWAVLCVACDRPRGCKGLGWGTEGPQGTGGLEPDLARGRWACQSCT
FENEAAAVLCSICERPRLAQPPSLVVDSRDAGICLQPLQQGDALLASAQSQVWYCIHCTF
CNSSPGWVCVMCNRTSSPIPVQHAPRPYASSLEKGPPKPGPPRRFSAPLPSSCGDPEKQR
QDKMREEGLHLVSMIREGEAAGACPEEIFSALQYSGTEVPLQWLRSELPYVLEMVAELAG
QQDPGLGAFSCQEARRAWLDRHGNLDEAVEECVRTRRRKVQELQSLGFGPEEGSLQALFQ
HGGDVSRALTELQRQRLEPFRQRLWDSGPEPTPSWDGPDKQSLVRRLLAVYALPSWGRAE
LALSLLQETPRNYELGDVVEAVRHSQDRAFLRRLLAQECAVCGWALPHNRMQALTSCECT
ICPDCFRQHFTIALKEKHITDMVCPACGRPDLTDDTQLLSYFSTLDIQLRESLEPDAYAL
FHKKLTEGVLMRDPKFLWCAQCSFGFIYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRS
CEDFQNWKRMNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSG
CYNAFYAKNKCPDPNCRVKKSLHGHHPRDCLFYLRDWTALRLQKLLQDNNVMFNTEPPAG
ARAVPGGGCRVMEQKEVPNGLRDEACGKETPAGYAGLCQAHYKEYLVSLINAHSLDPATL
YEVEELETATERYLHVRPQPLAGEDPPAYQARLLQKLTEEVPLGQSIPRRRK
Download sequence
Identical sequences G1RZ82
XP_003260711.1.23891 ENSNLEP00000018559 ENSNLEP00000018559 ENSNLEP00000023791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]