SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018590 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018590
Domain Number 1 Region: 1-182
Classification Level Classification E-value
Superfamily Cyclophilin-like 9.79e-53
Family Cyclophilin (peptidylprolyl isomerase) 0.0000274
Further Details:      
 
Domain Number 2 Region: 223-326
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.3e-28
Family Canonical RBD 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018590   Gene: ENSNLEG00000015316   Transcript: ENSNLET00000019520
Sequence length 409
Comment pep:novel supercontig:Nleu1.0:GL397266.1:41498130:41531220:-1 gene:ENSNLEG00000015316 transcript:ENSNLET00000019520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVLLETTLGDVVIDLYTEERPRACLNFLKLCKIKYYNYCLIHNVQRDFIIQTGDPTGTG
RGGESIFGQLYGDQASFFEAEKVPRIKHKKKGTVSMVNNGSDQHGSQFLITTGENLDYLD
GVHTVFGEVTEGMDIIKKINETFVDKDFVPYQDIRINHTVILDDPFDDPPDLLIPDRSPE
PTREQLDSGRIGADEEIDDFKGRSAEEVEEIKAEKEAKTQAILLEMVGDLPDADIKPPEN
VLFVCKLNPVTTDEDLEIIFSRFGPIRSCEVIRDWKTGESLCYAFIEFEKEEDCEKAFFK
MDNVLIDDRRIHVDFSQSVAKVKWKGKGGKYTKSDFKEYEKEQDKPSNLVLKDKVKPKQD
TKYDLILDEQAEDSKSSHSHTSKKHKKKTRHCSEEKEDEDYMPIKNTNQ
Download sequence
Identical sequences ENSNLEP00000018590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]