SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018663 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018663
Domain Number 1 Region: 100-314
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.15e-62
Family DBL homology domain (DH-domain) 0.0000219
Further Details:      
 
Domain Number 2 Region: 299-425
Classification Level Classification E-value
Superfamily PH domain-like 4.56e-31
Family Pleckstrin-homology domain (PH domain) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018663   Gene: ENSNLEG00000015370   Transcript: ENSNLET00000019596
Sequence length 1383
Comment pep:novel supercontig:Nleu1.0:GL397266.1:42652603:42803631:1 gene:ENSNLEG00000015370 transcript:ENSNLET00000019596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELSDSDRPVSFGSTSSSASSRDSHGSFGSRMTLVSNSHLGLFNQDKEVGAIKLELIPAR
PFSSSELQRDNPATEQQNADEGSERPPRAQWRVDSNGAPKTTTDSATSPKLLYVDRVVQE
ILETERTYVQDLKSIVEDYLDCIRDQTKLPLGTEERSALFGNIQDIYHFNSELLQDLENC
ENDPVAIAECFVSKSEEFHIYTQYCTNYPRSVAVLTECMRNKILAKFFRERQETLKHSLP
LGSYLLKPVQRILKYHLLLHEIENHLDKDTEGYDVVLDAIDTMQRVAWHINDMKRKHEHA
IRLQEIQSLLTNWKGPDLTSYGELVLEGTFRIQRAKNERTLFLFDKLLLITKKRDDTFTY
KAHILCGNLMLVEVIPKEPLSFSVFHYKNPKLQHTVQAKSQQDKRLWVLHLKRLILENHA
AKIPAKAEPAILEMDAIHEFYFLNTIGNFIVCLYLSHPMSGKNKRILKPSGGGSKFLSYV
SSPWCCDSVSREEGSPQLTSARPSPAQRNSQPSSSSMISVLRAGGALRNIWTDHQIRQAL
FPSRRSPQENEDDEDDYQMFVPSFSSSDLNSTRLCEDNTSSRPCSWHMGQMESTETPSSG
HRIVRRASSAGESNTCPPEIGTSDRTRELQNGPKTEGQEEMTPFGSSTELTIDDIDHVYD
NISYEDLKLMVAKREEVESTPSKSARDSARPKSTPELAFTKRQAGHSKGSLYAQKDGALS
GGEASSQSTHELQAVEENIYDTIGLPDPPSLGFKCSSLKRAKRSTFLGLEADFVCCDSLR
PFVSQDSLQFSEDEAPYHQATPDHDYLSLLYDSPSCNLSMPDKPVSDKLSEEVDEIWNDL
ENYIKKNEDKARDRLLAAFPVSKDDVPDRLHAESTPELSQDVGRSVSTLSLPESQALLTP
VKSRAGRASRANCPFEEDLISKEGSFMSLNRLSLASEMPLMDNPYDLANSGLSQTDSENP
DLGMEATDKTKSRVFMMARQYSQKIKKANQLLKVKSPELEQPPASQHQKSMHKDLAAILE
EKKQGGPAIGARIAEYSQLYDQIVFRESPLKIQKHGWASPQESSLLRSASPSQVHHGSED
WLLHSTYSNGELADFCLPPEQDLRSRYPMFEINTKSTPRQLSTACSVPSLQTSDPLPGSV
QRCSVVVSQPNKENWCQDHRYNSLDRKGISAKSQPYHRSQSSSSVLINKSMDSINYPSDM
GKQQLLSLHRSSRCESHQDLLPDIADSRQQGTEKLSDLTLQDSQKVVVVNRNLPLNAQIA
KQNYFSNFKETDGDEDDYVEIKSEEDESELEPSHNRRRKSDSKFVDADFSDNVCSGNTSH
SLNSPRTPKKPVNSKLGLSPYLTPYNDSDKLNDYLWRGPSPNQQNIVQSLREKFQCLSSS
SFA
Download sequence
Identical sequences ENSNLEP00000018663 ENSNLEP00000018663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]