SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018766 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018766
Domain Number 1 Region: 427-582
Classification Level Classification E-value
Superfamily Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain 2.22e-60
Family Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain 0.0000000657
Further Details:      
 
Domain Number 2 Region: 9-90,153-374
Classification Level Classification E-value
Superfamily RNI-like 8.63e-39
Family Rna1p (RanGAP1), N-terminal domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018766   Gene: ENSNLEG00000015464   Transcript: ENSNLET00000019707
Sequence length 583
Comment pep:novel supercontig:Nleu1.0:GL397297.1:21127957:21162416:-1 gene:ENSNLEG00000015464 transcript:ENSNLET00000019707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDGLEALRLEGNT
VGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPALVSEQAALPLHAQSPLLEWKP
GKSSMCPHMEGVTIVLLAVLCALTCTDGWCGMLKSSSILAAALTECHRKSSAQGKPLSLK
VFVAGRNRLENDGATALAEAFRVIGTLEEVHMPQNGINHPGITALAQAFAVNPLLRVINL
NDNTFTEKGAVAMAETLKTLRQVEVINFGDCLVRSKGAVAIADAIRGGLPKLKELNLSFC
EIKRDAALAVAEAMADKAELEKLDLNGNTLGEEGCEQLQEVLEGFNMAKVLTSLSDDEDE
EEEEGEEEEEEAEEEEEEEDEEEEEEEEEEEEEPQQQGQGEKSATPSRKILDPNTGEPAP
VLSSPPPADISTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEA
TVRTAVQDAVDALMKKAFSSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNH
MVQQDYFPKALAPLLLAFMTKPNSALESCSFARHSLLQTLYKV
Download sequence
Identical sequences ENSNLEP00000018766 ENSNLEP00000018766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]