SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018770 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018770
Domain Number 1 Region: 119-133,213-437
Classification Level Classification E-value
Superfamily RNI-like 1.33e-16
Family 28-residue LRR 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018770   Gene: ENSNLEG00000015452   Transcript: ENSNLET00000019712
Sequence length 507
Comment pep:novel supercontig:Nleu1.0:GL397509.1:278589:289724:-1 gene:ENSNLEG00000015452 transcript:ENSNLET00000019712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERRRLRGSIQSRYISMSVWTDPRRLVELAGQSLLKDEALAIAALELLPRELFPPLFMAA
FDGRHSQTLKAMVQTWPFTCLPLGVLMKGQQLHLETFKAVLDGLDVLLAQEVRPRRGKLQ
MLDLRKNSHQDFWTVWSGNRASLYSFPEPEAAQLMTKKRKVDGLSTEAEQPFIPIEVLVD
LSLKEGACDELFSYLIEKVKRKKNVLHLCCKKLKIFAMPLQNIKMILKMVQLDSIEDLEV
TCTWKLPTLAKFSHYLGQMINLRRLILSHIHVSSYISPEKEEQYIAQFTSQFLSLQCLQA
LYVDSLFFLRGRLDQLLRHVMNPLETLSITNCRLFKDVIHLSQSPSVSQLSVLSLSGVTL
TDISPEPQALLERASATLQDLDFDECGIIDDQLLVLLPSLSHCSQLTTLSFCGNPISLSA
LQSLLQHLIGLSNLTHVLYPVPLESYEDVHGTLHLGRLAYLHARLRELLCELGRPSMVWL
SANPCPHCGDRTLYDPEPILCPCFMPN
Download sequence
Identical sequences ENSNLEP00000018770 ENSNLEP00000018770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]