SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018787 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018787
Domain Number 1 Region: 165-319
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.21e-45
Family Dual specificity phosphatase-like 0.000019
Further Details:      
 
Domain Number 2 Region: 3-144
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 5.76e-24
Family Cell cycle control phosphatase, catalytic domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018787   Gene: ENSNLEG00000015479   Transcript: ENSNLET00000019729
Sequence length 384
Comment pep:novel supercontig:Nleu1.0:GL397265.1:44313218:44326526:1 gene:ENSNLEG00000015479 transcript:ENSNLET00000019729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVTSLDGRQLRKMLRKEAAARCVVLDCRPYLAFAASNVRGSLNVNLNSVVLRRARGGAV
SARYVLPDEAARARLLQEGGGGVAAVVVLDQGSRHWQKLREESAARVVLTSLLACLPAGP
RVYFLKGGYETFYSEYPECCVDVKPISQEKIESERALITQCGKPVVNVSYRPAYDQGGPV
EILPFLYLGSAYHASKCEFLANLHITALLNVSRRTSEACTTHLHYKWIPVEDSHTADISS
HFQEAIDFIDCVREKGGKVLVHCEAGISRSPTICMAYLMKTKQFRLKEAFDYIKQRRSMV
SPNFGFMGQLLQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPASV
LAPVPTHSTVSELSRSPVATATSC
Download sequence
Identical sequences A0A2I3HMF0
XP_003255506.1.23891 ENSNLEP00000018787 ENSNLEP00000018787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]