SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018804 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018804
Domain Number 1 Region: 1114-1332
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.67e-48
Family DBL homology domain (DH-domain) 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018804   Gene: ENSNLEG00000015498   Transcript: ENSNLET00000019747
Sequence length 1337
Comment pep:novel supercontig:Nleu1.0:GL397738.1:825:11193:-1 gene:ENSNLEG00000015498 transcript:ENSNLET00000019747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAEEAQHGASPPISAIEEFSIIPEAPMRSSQVSALGLEAQEDEDPSYKWREEHRLSATQ
QSELRDVCDYAIEMMPSFPKDGSADVEPNQESLVAEACDTLEHWEAVPQSLAGRQARTLA
PPELWACPIQSEHLDMAPFSSDLGSEEEEVEFWPGLTSLTLGSGQAEEEEETSSDNSGQT
RYYSPCEEHPAETNQNEGSESGTIRQGEELPSEELQESQGLLHPQEVQVLEEQGQQEAGF
RGEGTLREDVCADGLLGEEQMIEQVNGEKGEQKQKQEQVQEDVMLGRRGERTRLTGEPEG
LNDGEGEQEDMERTAQVQGGPEQGEERKRELRVPEENRADSQDEKSQSYVGKSEEVTGKQ
EDHGLKEKGVPVGGQEEKEPGSWDGGRLGAGGGARSREEENEHDGPSMPTLVAPEDSPHR
DLFPGASYLATQIPGTQTESRAEELYPTALSPSLEPIRCSHQPISLLGSFSTEESPDKEI
AQNSRQEGSRLRKGTVSSQGTEVVFASASVTPPRTPDSAPPSSAEASPITPASVSARPPV
AFPRRETSCAARAPETASAPLSMDDSAPWGTSEMCLAALHGFPSAGASPPRPPANSTGTI
QHLQSDSFPGSHRTEQTPDLVGMLLSSHSELPQRPPKPAIXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXMEDVRIHEPLPPPPERRDTHPFVVERDGHPRVVVPTLKQHSHPPPLA
LGSGPHAPHKGPLPQASDPTGARQHRPLPSTPDSSHHAQATPRWRYNKPLPPTPDLPQPH
LSPISAPGISRIYRPLPPLPIIDPPTEPPPLPPKSRGRSRSTRGGHMNSGGHAKTRPACQ
DWTVPIPASAGRTSWPPATGRSTESFTSTSRSKSEVSPGMAFSNMTNFLSPSSPTTPWTP
ELQGPTPKDEAGISEHPEAPAREPLRRTTPQQGASGPGRSPVGQARQPEKPSHLHLEKAS
SWPHRRDSGRPPGDSSGQAVAPSEGANKHKGWSRQLRRPSILPEGSSDRNSRGPAMEKHP
GPSDPVVFREKKTKEVMGGFSRRCSKLINSSQLLYQEYSDVVLNKEIQSQQRLESLSETS
GPSSPRQPRKALVSSESYLQRLSMASSGSLWQEIPVVRNSTVLLSMTHEDQKLQEVKFEL
IVSEASYLRSLNIAVDHFQLSTSLRATLSNQEHQWLFSRLQDVRDVSATFLSDLEENFEN
NIFSFQVCDVVLNHAPDFRRVYLPYVTNQTYQERTFQSLMTHPLFNPDAGPASDPVCQRL
SLKSFLILPFQRITRLKLLLQNILKRTQPGSSEEAEATKAHHALEQLIRDCNNNVQSMRR
TEELIYLSQKIEFECKV
Download sequence
Identical sequences ENSNLEP00000018804 ENSNLEP00000018804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]