SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018842 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018842
Domain Number 1 Region: 1048-1215
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.3e-46
Family BCR-homology GTPase activation domain (BH-domain) 0.0000922
Further Details:      
 
Domain Number 2 Region: 491-692
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.07e-44
Family DBL homology domain (DH-domain) 0.00055
Further Details:      
 
Domain Number 3 Region: 1-67
Classification Level Classification E-value
Superfamily Bcr-Abl oncoprotein oligomerization domain 7.06e-35
Family Bcr-Abl oncoprotein oligomerization domain 0.0000184
Further Details:      
 
Domain Number 4 Region: 706-775,833-868
Classification Level Classification E-value
Superfamily PH domain-like 2.83e-17
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 5 Region: 910-1009
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000103
Family PLC-like (P variant) 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018842   Gene: ENSNLEG00000015494   Transcript: ENSNLET00000019787
Sequence length 1269
Comment pep:novel supercontig:Nleu1.0:GL397509.1:703048:881048:1 gene:ENSNLEG00000015494 transcript:ENSNLET00000019787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQ
TLLAKEKKSYDRQRWGFRRAAQAPDGASEPRAFAPRPQPAPAEGADPPPAEESEARPDGE
GSPGKARPGAAHRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHSAGSSVGDASRPSYRGRSSEGSC
GVDGDYEDAELNPRFLKDNLINANGGSRSPWPPLEYQSYQSIYVGGMMEGEGKGPLLRSQ
STSEQEKRLTWPRRSYSPRSFEDCGGGYTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEG
AFHGDADGSFGTPPGYGCAADRAEEQRRHQDGLPYIDDSPSSSPHLSSKGRGSRDALVSG
ALESTKVSELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTS
QQIETIFFKVPELYEIHKEFYDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGV
AMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDL
LKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVE
GARKLRHVFLFTDLLLCTKLKKQSGGKTQQYDCKWYIPLTDLSFQMVDESEAVPNIPLVP
DEELDALKIKISQIKSDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRN
GKSYTFLISSDYERAEWRENIREQQKKCFKSFSLTSVELQMLTNSCVKLQTVHSIPLTIN
KEDDESPGLYGFLNVIVHSATGFKQSSNLYCTLEVDSFGYFVNKAKTRVYRDTAEPNWNE
EFEIELEGSQTLRLCYEKCYNKTIPKEDGESTDRLMGKGRSRLDPQALQDRDWQRTVIAM
NGIEVKLSVKFNSREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIMRQCVEEIERRG
MEEVGLYRMSGVVVDIQALKAAFDVNNKDVSVMMSEMDVNTIAGTLKLHFHELPEPLFTD
EFYPNFAEGITLSDPVAKKSCMLNLLLSLPGANLLTFLFLLDHLERVAEKEAVNKMSLHN
LATVFGPKLLQPSEKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLWLEAIPALDSKR
QSILFSTDV
Download sequence
Identical sequences ENSNLEP00000018842 ENSNLEP00000018842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]