SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018883 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018883
Domain Number 1 Region: 932-1043
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-28
Family PDZ domain 0.00082
Further Details:      
 
Domain Number 2 Region: 543-657
Classification Level Classification E-value
Superfamily PH domain-like 1.78e-25
Family Third domain of FERM 0.0041
Further Details:      
 
Domain Number 3 Region: 437-542
Classification Level Classification E-value
Superfamily Second domain of FERM 2.49e-24
Family Second domain of FERM 0.00077
Further Details:      
 
Domain Number 4 Region: 764-859
Classification Level Classification E-value
Superfamily PDZ domain-like 4.73e-22
Family PDZ domain 0.02
Further Details:      
 
Domain Number 5 Region: 1057-1168
Classification Level Classification E-value
Superfamily PDZ domain-like 3.68e-20
Family PDZ domain 0.023
Further Details:      
 
Domain Number 6 Region: 343-432
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000775
Family First domain of FERM 0.048
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000018883
Domain Number - Region: 77-163
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000341
Family Protein kinases, catalytic subunit 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018883   Gene: ENSNLEG00000015507   Transcript: ENSNLET00000019832
Sequence length 1309
Comment pep:novel supercontig:Nleu1.0:GL397429.1:594355:718367:-1 gene:ENSNLEG00000015507 transcript:ENSNLET00000019832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPLTKDAGMSLSSVTLASALQVRGEALSEEEIWSLLFLAAEQLLEDLRNDSLDYVVCPW
SALLSAAGSLSFQGHVSHIEAAPFKAPELLQGQSEDEQPDASQMHVYSLGMTLYWSAGFH
VPPHQPLQLREPLHSILLTMCEDQPHRRCTLQSVLEACRVHEKEVSVYPAPAGLHIRRLV
GLVLGTISEVEKRVVEETSSVQQNRSYLLRKRLHGTSSESPAAQAPECLHPCRVSERSTE
TQSSPEPRWSTSTHSHCSLLVNRTLPGADPQDQQEGRRLSSGSVHSAADSSWPTTPSQRG
FLQRRSKFSRPEFILLAGEAPMTLHLPGSVVTKKGKSYLALRDLCVVLLNGQHLEVKCDV
ESTVGAVFNAVTSFANLEEFTYFGLAYMKGKEFFFLDSETRLCKIAPEGWREQPQKTSMN
TFTLFLRIKFFVSHYGLLQHSLTRHQFYLQLRKDILEERLYCNEEMLLQLGVLALQAEFG
NYPKEQVESKPYFHVEDYIPVSLIERMTALRVQVEVSEMHRLGSALWGEDAELEFLKVTQ
QLPEYGVLVHQVFSEKRRPEEEMALGICAKGVIVYEVKNNSRIATLRFQWRETGKISTYQ
KKFTITSSVTGKKHTFVTDSAKTSKYLLDLCSAQHGFNAQMGSGQPSHVLFDHDKFVQMA
NLSPAHQAQSKPLIWIQRLSCSENELFASRLQDAGGGLLSTSLDNFNVDGSKEAGAEGIG
RSPCTGREQLKSACVIQKPMTWDSLSGPPVQSMHAGSKNNRRKSFTAEPGREIVCVTLKR
DPHRGFGFVINEGEYSGQADPGIFISSVIPGGPAEKAKTIKPGGQILALNHISLEGFTFN
MAVRMIQNSPDNIELIISQSKGVGGNNPDEEKNSTANSGVSSTDILSFGYQGSLLSHTQD
QDRNIEELDMAGVQSLVPRLRHQLSFLPLKGAASSCPPSPPEISAGEIYFVELVKEDGTL
GFSVTGGINTSVPYGGIYVKSIVPGGPAAKEGQILQGDRLLQVDGVSLCGLTHKQAVHCL
KGPGQVARLVLERRGPRTTQQCPSANDSMGDEHTAVSLVTALPGRPSSCVSVTDGPKFEV
KLKKNVNGLGFSFVQMEKESCSQLKSDLVRIKRLFPGQPAEENGAIAAGDIILAVNGRST
EGLIFQEVLHLLRGAPQEVTLLLCRPPPGALPEMEQEWQTPELSADKEFTRATRTDSCTS
PILDQEDNWRDSASPDAGEGLGLRPESSQKAIREAQWGQNRERPWASSLTHSPESHPHLC
KLHQERDASTLATSLEKDMRQNCYSVCDIMRLGRYSFSSPLTRLSTDIF
Download sequence
Identical sequences G1S055
ENSNLEP00000018883 ENSNLEP00000018883 XP_003278204.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]