SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018928 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018928
Domain Number 1 Region: 499-764
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.11e-80
Family Protein kinases, catalytic subunit 0.0000213
Further Details:      
 
Domain Number 2 Region: 336-454
Classification Level Classification E-value
Superfamily PH domain-like 2.74e-32
Family Pleckstrin-homology domain (PH domain) 0.0000118
Further Details:      
 
Domain Number 3 Region: 38-110
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.2e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00071
Further Details:      
 
Domain Number 4 Region: 176-234
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.24e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018928   Gene: ENSNLEG00000015603   Transcript: ENSNLET00000019880
Sequence length 825
Comment pep:novel supercontig:Nleu1.0:GL397280.1:8696455:8842564:-1 gene:ENSNLEG00000015603 transcript:ENSNLET00000019880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFPECGFYGMYDKILLFRHDPTSENILQLVKTASDIQEGDLIEVVLSASATFEDFQIRPH
ALFVHSYRAPAFCDHCGEMLWGLVRQGLKCEGCGLNYHKRCAFKIPNNCSGVRRRRLSNV
SLTGVSTIRTSSAELSTSAPDEPLLQKSPSESFIGREKRSNSQSYIGRPIELDKILMSKV
KVPHTFVIHSYTRPTVCQYCKKLLKGLFRQGLQCKDCRFNCHKRCAPKVPNNCLGEVTIN
GDLLSPGAESDVVMEEGSDDNDSERNSGLMDDMEEAMVQDAEMAMAECQNDSGEMQDPDP
DHEDANRTISPSTSNNIPLMRVVQSVKHTKRKSSTVMKEGWMVHYTSKDTLRKRHYWRLD
SKCITLFQNDTGSRYYKEIPLSEILSLEPAKTSALIPNGANPHCFEITTANVVYYVGENV
VSPSSPPPNNSVLTSGVGADVARMWEIAIQHALMPVIPKGSSVGTGTNLHRDISVSISVS
NCQIQENVDISTVYQIFPDEVLGSGQFGIVYGGKHRKTGRDVAIKIIDKLRFPTKQESQL
RNEVAILQNLHHPGVVNLECMFETPERVFVVMEKLHGDMLEMILSSEKGRLPEHITKFLI
TQILVALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFARIIGEKSFRRSVVGTP
AYLAPEVLRNKGYNRSLDMWSVGVIIYVSLSGTFPFNEDEDIHDQIQNAAFMYPPNPWKE
ISHEAIDLINNLMQVKMRKRYSVDKTLSHPWLQDYQTWLDLRELECKIGERYITHESDDL
RWEQYAGEQGLQYPTHLINPSASHSDTPETEETEMKALGERVSIL
Download sequence
Identical sequences ENSNLEP00000018928 ENSNLEP00000018928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]