SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019081 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019081
Domain Number 1 Region: 399-859
Classification Level Classification E-value
Superfamily RNI-like 8.89e-39
Family 28-residue LRR 0.0056
Further Details:      
 
Domain Number 2 Region: 1-84
Classification Level Classification E-value
Superfamily DEATH domain 2.64e-19
Family Caspase recruitment domain, CARD 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000019081
Domain Number - Region: 122-195
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00749
Family Nucleotide and nucleoside kinases 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019081   Gene: ENSNLEG00000015720   Transcript: ENSNLET00000020042
Sequence length 865
Comment pep:novel supercontig:Nleu1.0:GL397288.1:11857083:11909227:-1 gene:ENSNLEG00000015720 transcript:ENSNLET00000020042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NFIKDNSRALIQRMGMTVIKQITDDLFVWNVLYCEEVNIICCEKVEQDATRGIIHMILKK
GSEACNLFLKSLEEWNYPLFQDLNGQSLFHQISEGDLDDLAQDLKDLYHTPSFLNFYPLG
EDIDIIFNLKSTFTEPVLWRKDQHHHRVEQLTLNGLLPALQSPCIIEGESGKGKSTLLQR
IAMLWGSGKCKALTKFKFVFFLRLSRAQGGLFETKNKHKHKGVAASDFIRSLDHCGDLAL
EGVFSHFDFELEDVSSVNEDVLLTTGLLCKYTAQRFKPKYKFFHKSFQEYTAGRRLSSLL
TSREPEEVTKGNGYLQKMVSISDITSTYSSLLRYTCGSSVEATRAVMKHLAAVYQHGCLL
GLSVAKRPLWRQESLQSVKNTTEQEILKAININSFVECGIHLYQESTSKSALSQEFEAFF
QGKSLYINSGNIPDYLFDFFEHLPNCASALDFIKLDFYGGAMASWEKAAEDTGGIHMEEA
PETYIPSRAVSLFFNWKQEFRTLEVTLRDFSKLNKQDIKYLGKIFSSATSLRLQIKRCAG
VAGSLSLVLSTCKNIYSLMVEASPLTIEDEWHITSVTNLKTLSIHDLQNQRLPGGLTDSL
GNLKNLTKLIMDNIKMNEEDAIKLAEGLKNLKKMCLLRLTHLSDIGEGMDYIVKSLSSEP
CDLEEIQLVSCCLSANAVKILAQNLHNLVKLSILDLSENYLEKDGNEALHELIDRLNMLE
QLTALLLPWGCDVQGSLTSLLKQLEEVPQLTKLGLKNWGLTDTEIRILGAFFGKNPLKNF
QQLNLAGNRVSSDGWLAFMGVFGNLKQLVFFDFSTKEFLPDAALVRKLSHVLSKLTFLQE
ARLVGWQFDDDDLSVIKGAFKLVTA
Download sequence
Identical sequences ENSNLEP00000019081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]