SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019292 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019292
Domain Number 1 Region: 123-479
Classification Level Classification E-value
Superfamily ARM repeat 2.16e-108
Family Diap1 N-terninal region-like 0.0000000107
Further Details:      
 
Domain Number 2 Region: 710-1038
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 8.37e-104
Family Formin homology 2 domain (FH2 domain) 0.00000000264
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000019292
Domain Number - Region: 575-630
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0445
Family beta-sandwich domain of Sec23/24 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019292   Gene: ENSNLEG00000015843   Transcript: ENSNLET00000020266
Sequence length 1193
Comment pep:novel supercontig:Nleu1.0:GL397270.1:7292141:7805682:-1 gene:ENSNLEG00000015843 transcript:ENSNLET00000020266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERHRPRLHHPAQGSAAGTPYPSSASLRGCRESKMPRRKGPQHPPPPGGPEEPGEKRPKF
HLNIRTLTDDMLDKFASIRIPGSKKERPPLPNLKTTFASSDCSAAPLEMMENFPKPLSEN
ELLELFEKMMKRMNLNEDKKAPLREKDFSIKKEMVMQYINTASKTGSLKRSRQISPQEFI
HELKMGSADERLVTCLESLRVSLTSNPVSWVESFGHEGLGLLLDILEKLISGKIQEKVVK
KNQHKVIQCLKALMNTQYGLERIMSEERSLSLLAKAMDPRHPNMMTDVVKLLSAVCIVGE
ESILEEVLEALTSAGEEKKIDRFFCIVEGLQHNSVQLQVACMQLINALVTSPDDLDFRLH
IRNEFMRCGLKEILPNLKRIKNDGLDIQLKVFDEHKEEDLVELSHRLEDIRAELDEAYDV
YNMVWSTVKETRAEGYFISILQHLLLIRNDYFIRQQYFKLIDECVSQIVLHRDGMDPDFT
YRKRLDLDLTQFVDICVDQAKLEEFEEKASELYKKFEKEFTDHQETQVELQKKEAKINEL
QAELQAFKSQFGAFPADCNIPLPPSNEGETGHSALPPPPPLPSGGGVPPPPPPPPPPPLP
GMRMPFGGLVPPPPPLGFLGGQNSPPLPTLPFGLKPKKEFKPEISMRRLNWLKIRPHEMT
ENCFWIKVNENKYENVDLLCKLENTFCCQQKEKREEEDTEEKKSIKKKIKELKFLDSKIA
QNLSIFLSSFRVPYEEIRMMILEVDETRLAESMIQNLIKHLPDQEQLNSLSQFKSEYNNL
CEPEQFVVVMSNVKRLRPRLSAILFKLQFEEQVNNIKPDIMAVSTACEEIKKSKSFSKLL
ELVLLMGNYMNAGSRNAQTFGFNLSSLCKLKDTKSADQKTTLLHFLVEICEEKYPDILNF
VDDLEPLDKASKVSVETLEKNLRQMGRQLQQLEKELETFPPPEDLHDKFVTKMSRFVISA
KEQYETLSKLHENMEKLYQSIMGYYATDVKKVSVEDFLTDLNNFRTTFMQAIKENIKKRE
AEEKEKRARIAKELAERERLERQQKKKRLLEMKTEGDETGVMDNLLEALQSGAAFRDRRK
RTPMRKDVRQSLSPMSQRPVLKVCNHENQKVQLTEGSRSHYNINCNSTRTPVAKELNYNL
DTHTSTGRIKAAEKKEACNVESNRKKETELLGSFSKNESVPEVEALLARLRAL
Download sequence
Identical sequences ENSNLEP00000019292 ENSNLEP00000019292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]