SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019429 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019429
Domain Number 1 Region: 192-251
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000164
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.014
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000019429
Domain Number - Region: 231-240,272-291,441-492
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00046
Family Cytochrome c3-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019429   Gene: ENSNLEG00000015994   Transcript: ENSNLET00000020411
Sequence length 512
Comment pep:novel supercontig:Nleu1.0:GL397503.1:1193377:1210127:1 gene:ENSNLEG00000015994 transcript:ENSNLET00000020411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVLSLRAPGPWQAIQVWADRTLLTAHTGVTSQVLGVAAAVMTPLPGGHTQGRTREARWD
AMEYDEKLARFRRAHLNPFNKQSGPRQHEQGPGEEAPDVTPEEALPELPPGEPEFRCPER
VMDLGLSEDHFSRPVGLFLASDVQQLRQAIEECKQVILELPEQSEKQKDAVVRLIHLRLK
LQELKDPNEDEPNIRVLLEHRFYKEKSKSVKQTCDKCNTIIWGLIQTWYTCTGCYYRCHS
KCLNLISKPCVSSKVSHQAEYELNICPETGLDSQDYRCAECRAPISLRGVPSEARQCDYT
GQYYCSHCHWNDLAVIPARVVHNWDFEPRKVSRCSMRYLALMVSRPVLRLREINPLLFNY
VEELVEIRKLRQDILLMKPYFITCREAMEARLLLQLQDRQHFVENDEMYSVQDLLDVHAG
RLGCSLTEIHTLFAKHIKLDCERCQAKGFVCELCREGDVLFPFDSHTSVCADCSAVFHRD
CYYDNSTTCPKCARLSLRKQSLFREPGPDVEA
Download sequence
Identical sequences ENSNLEP00000019429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]