SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019473 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019473
Domain Number 1 Region: 439-665
Classification Level Classification E-value
Superfamily RNI-like 1.16e-29
Family Cyclin A/CDK2-associated p19, Skp2 0.038
Further Details:      
 
Domain Number 2 Region: 81-152
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000403
Family PHD domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019473   Gene: ENSNLEG00000016063   Transcript: ENSNLET00000020458
Sequence length 693
Comment pep:novel supercontig:Nleu1.0:GL397496.1:655934:677469:1 gene:ENSNLEG00000016063 transcript:ENSNLET00000020458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGMEVPGKGESGPSALLTPPMSSSSRGPGAGARRRRTRCRRCRACVRTECGDCHFCRDMK
KFGGPGRMKQSCLLRQCTAPVLPHTAVCLLCGEAGKEDTVEGEEEKFGLSLMECTICNEI
VHPGCLKMGKAEGVINAEIPNCWECPRCTQEGRTSKDSGEGPGRRRADNGEEGASLGSGW
KLTEEPTLPPPPPRRKGPLPAGPPPEDVPGPPKRKEREAGNEPPTPRKKVKGGRERHLKK
VGGDACLLRGSDPGGPGLLPPRVLNPSQAFSSCHPGLPPENWEKPKPPLASAEGPAVPSP
SPQREKLERFKRMCQLLERPDTSSSSSDSDSDSDSSGTSLSEDEAPGEARNGRRPARGSS
GEKENRGGRRAVRPGSGGPLLSWPLGPAPPPRPPQLERHVVRPPPRSPEPDTLPLAAGSD
HPLPRAAWLRVFQHLGPRELCICMRVCRTWSRWCYDKRLWPRMDLSRRKSLTPPMLSGVV
RRQPRALDLSWTGVSKKQLMWLLNRLQGLQELVLSGCSWLSVSALGSAPLPALRLLDLRW
IEDVKDSQLRELLLPPPDTKPGQTESRGRLQGVAELRLAGLELTDASLRLLLRHAPQLSA
LDLSHCAHVGDPSVHLLTAPTSPLRETLVHLNLAGCHRLTDHCLPLFRRCPRLRRLDLRS
CRQLSPEACARLAAAGPPGPFRCPEEKLLLKDS
Download sequence
Identical sequences A0A2I3GBU6
ENSNLEP00000019473 ENSNLEP00000019473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]