SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019573 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019573
Domain Number 1 Region: 6-195
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.62e-48
Family G proteins 0.0000816
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019573   Gene: ENSNLEG00000016147   Transcript: ENSNLET00000020563
Sequence length 211
Comment pep:novel supercontig:Nleu1.0:GL397264.1:1692009:1754087:1 gene:ENSNLEG00000016147 transcript:ENSNLET00000020563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAPHREHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKVLHWDPETVVR
LQLWDIAGQERFGNMTRVYYREAMGAFIVFDVTRPATFEAVAKWKNDLDSKLSLPNGKPV
SVVLLANKCDQGKDVLMNNGLKMDQFCKEHGFVGWFETSAKENINIDEASRCLVKHILAN
ECDLMESIEPDVVKPHLTSTKVASCSGCAKS
Download sequence
Identical sequences G1S235
XP_003254567.1.23891 ENSNLEP00000019573 ENSNLEP00000019573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]