SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019612 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019612
Domain Number 1 Region: 87-368
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.37e-55
Family Asparaginyl hydroxylase-like 0.068
Further Details:      
 
Domain Number 2 Region: 1075-1281
Classification Level Classification E-value
Superfamily RNI-like 9.42e-22
Family 28-residue LRR 0.075
Further Details:      
 
Domain Number 3 Region: 649-727
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000302
Family PHD domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019612   Gene: ENSNLEG00000016168   Transcript: ENSNLET00000020602
Sequence length 1330
Comment pep:novel supercontig:Nleu1.0:GL397489.1:1198061:1363945:-1 gene:ENSNLEG00000016168 transcript:ENSNLET00000020602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPQMGGSAEDHPPRKRHAAKKQKKKIIYTKCFEFESATQRDRQQCLRSGDYDVDASPP
PQLLKMEVSVRARLWGDEAAAGAFWDFNYEYVQREALRVPLIFREKDGLGIKMPDPDFTV
RDVKLLVGNRRLVDVMDVNTQKGTEMSMSQFVRYYETPEAQRDKLYNVISLEFSHTKLEH
LVKRPTVVDLVDWVDNMWPQHLKEKQTEATNAIAEMKYPKVKKYCLMSVKGCFTDFHIDF
GGTSVWYHVFRGGKIFWLIPPTLHNLALYEEWVLSGKQSDIFLGDRVERCQRIELKQGYT
FFIPSGWIHAVYTPVDSLVFGGNILHSFNVPMQLRIYEIEDRTRVQPKFRYPFYYEMCWY
VLERYVYCVTQRSHLTQEYQRESMLIDAPRKPSIDGFSSDSWLEMEEEACDQQPQEEEEK
DEEGEGRDRAPKPPTDGSTSPTSTPSEDQEALGKKPKAPALRFLKRTLSNESEESVKSTT
LPVDYPKTPTGSPATEVSAKWTHLTEFELKGLKALVEKLESLPENKKCVPEGIEDPQALL
EGVKNVLKEHADDDPSLAITGVPVVTWPKKTPKNRAVGRPKGKLGPASAVKLAANRTTAG
ARRRRTRCRKCEACLRTECGECHFCKDMKKFGGPGRMKQSCIMRQCIAPVLPHTAVCLVC
GEAGKEDTVEEEEGKFNLMLMECSICNEIIHPGCLKIKESEGVVNDELPNCWECPKCNHA
GKTGKQKRGPGFKYASNLPGSLLKEQKMNRDNKEGQEPAKRRSECEEAPRRRSDEHPKKV
PPDGLLRRKSDDVHLRKKRKYEKPQELSGRKRASLQTSPGSSSHLSPRPPLGSSLSPWWR
SSLTYFQQQLKPGKEDKLFRKKRRSWKNAEDRMALANKPLRRFKQEPEDDLPEAPPKTRE
SDHSRSSSPTAGPSTEGAEGPEEKKKVKMRRKRRLPNKELSRELSKELNHEIQRTENSLA
NENQQPIKSEPESEGEEPKRPPGICERPHRFSKGLNGTPRELRHQLGPSLRSPPRVISRP
PPSVSPPKCMQMERHVIRPPPISPPPDSLPLDDGAAHVMHREVWMAVFSYLSHQDLCVCM
RVCRTWNRWCCDKRLWTRIDLNHCKSITPLMLSGIIRRQPVSLDLSWTNISKKQLSWLIN
RLPGLRDLVLSGCSWIAVSALCSSSCPLLRTLDVQWVEGLKDAQMRDLLSPPTDNRPGQM
DNRSKLRNIVELRLAGLDITDASLRLIIRHMPLLSKLHLSYCNHVTDQSINLLTAVGTTT
RDSLTEINLSGDSAFTCECLRVYRQLSSTTAPGSRIGRAVTKEGCEQFIAEMSVSVQFGQ
VEEKLLQKLS
Download sequence
Identical sequences ENSNLEP00000019612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]