SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019700 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019700
Domain Number 1 Region: 32-116
Classification Level Classification E-value
Superfamily F-box domain 1.44e-16
Family F-box domain 0.0046
Further Details:      
 
Domain Number 2 Region: 98-259,332-391
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000392
Family 28-residue LRR 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019700   Gene: ENSNLEG00000016246   Transcript: ENSNLET00000020692
Sequence length 428
Comment pep:novel supercontig:Nleu1.0:GL397270.1:24549215:24571274:-1 gene:ENSNLEG00000016246 transcript:ENSNLET00000020692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRRGRDSDRNSSEEGATEKTKKLRTTNEHSQTCDWGNLLQDIILQVFKYLPLLDRAHAS
QVCRNWNQVFHMPDLWRCFEFELNQPATSYLKATHPELIKQIIKRHSNHLQYVSFKVDSS
KESAEAACDILSQLVNCSLKTLGLISTARPSFMDLPKSHFISALTVVFVNSKSLSSLKID
DTPVDDPSLKVLVANNSDTLKLLKMSSCPHVSPAGILCVADQCHGLRELALNYHLLSDEL
LLALSSEKHVRLEHLRIDVVSENPGQTHFHTIQKSSWDAFIRHSPKVNLVMYFFLYEEEF
DPFFRYEIPATHLYFGRSVSKDVLGRVGMTCPRLVELVVCANGLRPLDEELIRIAERCKN
LSAIGLGECEVSCSAFVEFVKMCGGRLSQLSIMEEVLIPDQKYSLEQIHWEVSKHLGRVW
FPDMMPTW
Download sequence
Identical sequences G1S2G2
ENSNLEP00000019700 ENSNLEP00000019700 XP_003257396.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]