SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019773 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019773
Domain Number 1 Region: 798-940
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 8.5e-58
Family FAT domain of focal adhesion kinase 0.00000707
Further Details:      
 
Domain Number 2 Region: 351-631
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.25e-52
Family Protein kinases, catalytic subunit 0.000000392
Further Details:      
 
Domain Number 3 Region: 204-300
Classification Level Classification E-value
Superfamily PH domain-like 2.7e-26
Family Third domain of FERM 0.00026
Further Details:      
 
Domain Number 4 Region: 2-71
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.3e-23
Family First domain of FERM 0.00062
Further Details:      
 
Domain Number 5 Region: 72-161
Classification Level Classification E-value
Superfamily Second domain of FERM 6.7e-19
Family Second domain of FERM 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019773   Gene: ENSNLEG00000016291   Transcript: ENSNLET00000020768
Sequence length 943
Comment pep:novel supercontig:Nleu1.0:GL397351.1:5630783:5671558:1 gene:ENSNLEG00000016291 transcript:ENSNLET00000020768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQEIITSILLSGRIGPNIQLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYECLHVEAE
WRYDLQIRYLPEDFMESLKEDRTTLLYFYQQYLNEHTNIHTYNISEIANNIGCLGPLRFF
KDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKAQSLQILRQQGLADLPSVEDRQGV
RRGKSIWPAFRTALGQQSTLFLFQQGWNITVDLVIGPKGIRQLTSQDAKPTCLAEFKQIR
SIRCLLLEEGQAVLQLGIEGAPQALSIKTSSLAEAENMADLIDGYCRLQGEHQGSLIIHP
RTDGEKRNSLPQIPMLNLEARRSHLSESCSIESDIYAEIPDETLRRPGGPQYGIAREDVV
LNRILGEGFFGEVYEGVYTNHKGEQINVAVKTCKKDCTLDNKEKFMSEAVQGPMLEEGSP
SSQLEEQRPFLNGTFEPLHLSLLPPTHTARNKNSLKVLTLVLYSLQICKAMAYLESINCV
HRDIAVRNILVASPECVKLGDFGLSRYIEDEDYYKASVTRLPIKWMSPESINFRRFTTAS
DVWMFGSSSWKRLFFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPVLYTLMTRCWDYDP
SDRPRFTELACSLSDIYQMEKDIAMEQERNARYRTPKILEPTTFQEPPPKPSRPKYRPPP
QTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMREEDFIR
PSSREEAQQLWEAEKIKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSPLTPEKE
VGYMEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLELKNELCQLPPEGY
VVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVT
SLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE
Download sequence
Identical sequences ENSNLEP00000019773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]