SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019836 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019836
Domain Number 1 Region: 436-676,708-782
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 3.27e-58
Family Diacylglycerol kinase-like 0.013
Further Details:      
 
Domain Number 2 Region: 5-99,130-157
Classification Level Classification E-value
Superfamily EF-hand 3.53e-41
Family EF-hand modules in multidomain proteins 0.0015
Further Details:      
 
Domain Number 3 Region: 132-222
Classification Level Classification E-value
Superfamily EF-hand 2.54e-21
Family Calmodulin-like 0.015
Further Details:      
 
Domain Number 4 Region: 227-296
Classification Level Classification E-value
Superfamily Cysteine-rich domain 8.97e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0031
Further Details:      
 
Domain Number 5 Region: 299-363
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000254
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019836   Gene: ENSNLEG00000016331   Transcript: ENSNLET00000020833
Sequence length 804
Comment pep:novel supercontig:Nleu1.0:GL397261.1:36524705:37240853:-1 gene:ENSNLEG00000016331 transcript:ENSNLET00000020833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTNQEKWAHLSPSEFSQLQKYAEYSTKKLKDVLEEFHGNGVLAKYNPEGKQDILNQTIDF
EGFKLFMKTFLEAELPDDFTAHLFMSFSNKFPHSSPMVKSKPALLSGGLRMNKGAITPPR
TTSPANTCSPEVIHLKDIVCYLSLLERGRPEDKLEFMFRLYDTDGNGFLDSSELENIISQ
MMHVAEYLEWDVTELNPILHEMMEEIDYDHDGTVSLQEWIQGGMTTIPLLVLLGLENNVK
DDGQHVWRLKHFNKPAYCNLCLNMLIGVGKQGLCCSFCKYTVHERCVARAPPSCIKTYVK
SKRNTDVMHHYWVEGNCPTKCDKCHKTVKCYQGLTGLHCVWCQITLHNKCASHLKPECDC
GPLKDHILPPTTICPVVLQTLPTSGVSVPEERQSTVKKEKSGPQQPNKVIDKNKMQRANS
VTVDGQGLQITPVPGTHPLLVFVNPKSGGKQGERIYRKFQYLLNPRQVYSLSGNGPMPGL
NFFRDVPDFRVLACGGDGTVGWVLDCIEKANVGKHPPVAILPLGTGNDLARCLRWGGGYE
GENLMKILKDIENSTEIMLDRWKFEVIPNDKDEKGDPVPYSIINNYFSIGVDASIAHRFH
IMREKHPEKFNSRMKNKFWYFEFGTSETFSATCKKLHESVEIECDGVQIDLINISLEGIA
ILNIPSMHGGSNLWGESKKRRSHRRIEKKGSDKRTTVTDAKELKFASQDLSDQLLEVVGL
EGAMEMGQIYTGLKSAGRRLAQCSCVLIRTSKSLPMQIDGEPWMQTPCTIKITHKNQAPM
LMGPPPKTGLFCSLVKRTRNRSKE
Download sequence
Identical sequences G1S2U8
XP_012365680.1.23891 ENSNLEP00000019836 ENSNLEP00000019836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]