SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019878 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019878
Domain Number 1 Region: 327-425,492-511,584-680
Classification Level Classification E-value
Superfamily RNI-like 1.36e-25
Family Cyclin A/CDK2-associated p19, Skp2 0.072
Further Details:      
 
Domain Number 2 Region: 200-293
Classification Level Classification E-value
Superfamily F-box domain 2.62e-18
Family F-box domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019878   Gene: ENSNLEG00000016352   Transcript: ENSNLET00000020876
Sequence length 691
Comment pep:novel supercontig:Nleu1.0:GL397274.1:7730952:7787519:-1 gene:ENSNLEG00000016352 transcript:ENSNLET00000020876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPFPEEVDVFTAPHWRMKQLVGLYCDKLSKTNFSNNNDFRALLQSLYATFKEFKMHEQI
ENEYIIGLLQQRSQTIYNVHSDNKLSEMLSLFEKGLKNVKNEYEQLNYAKQLKERLEAFT
RDFLPHMKEEEEVFQPMLMEYFTYEELKDIKKKVIAQHCSQKDTAELLRGLSLWNHAEER
QKFFKYSVDEKSDKEAEVSEHSTGITHLPPEVMLSIFSYLNPQELCRCSQVSMKWSQLTK
TGSLWKHLYPVHWARGDWYSGPATELDTEPDEEWVKNRKDESRAFHEWDEDADIDESEES
AEESIAISIAQMEKRLLHGLIHNVLPYVGTSVKTLVLAYSSAVSSKMVRQILELCPNLEH
LDLTQTDISDSAFDSWSWLGCCQSLRHLDLSGCEKITDVALEKISRALGILTSYQSGFLK
TSTSKITSTTWKNKDITMQSTKQYACLHDLTNKGIGEEIDNEHPWTKPVSSENFTSPYVW
MLDAEDLADIEDAVEWRHRNVESLCVMETASNFSCSTSGCFSKDIVGLRTSVCWQQHCAS
PAFAYCGHSFCCTGTALRTMSALPESSAMCRKASRTRLPRGKDLIYFGSEKSDQETGRVL
LFLSLSGCYQITDHGLRVLTLGGGLPYLEHLNLSGCLTITGAGLQDLVSACPSLNDEYFY
YCDNINGPHADTASGCQNLQCGFRACCRSGE
Download sequence
Identical sequences G1S2Z0
ENSNLEP00000019878 XP_003258549.1.23891 ENSNLEP00000019878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]