SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019949 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019949
Domain Number 1 Region: 261-436
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-24
Family DBL homology domain (DH-domain) 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019949   Gene: ENSNLEG00000016438   Transcript: ENSNLET00000020948
Sequence length 869
Comment pep:novel supercontig:Nleu1.0:GL397288.1:18785307:18840845:1 gene:ENSNLEG00000016438 transcript:ENSNLET00000020948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKNKTKQGENEHMPVNNPSTQIYQLQALASELKTGFTEAMQELSRIQHGEYALEEKVKS
CRCSMEEKVTEMKNSLNYFKEELSNAMSMIQAITSKQEEMQQKIEQLQQEKRRESRKVKA
KKTQKEEHSSQAGPAQAQGSPFRSINIPEPVLPSEDFTNLLPSQAYEKAQESRSVHVGDS
NVKGMMGPGVNPTTPEAEENLKSCLSADIQSKGHLPSGMWRQPKDGKEWGEEYVTKDHPD
KLKEAGQGRHSSLENVLCETSLAAKRQTVALELLESERKYVINISLILKIKATFQGSDGK
RNSKERSLFPGSLRYLVQQHLDLLHALQERVLKWPLQGVLGDLFLKLTNDENNFLDYYVA
YLRDLPECISLVHVVVLKEGDEEIKSDIYTLFFHIVQRIPEYLIHLQNVLKFTEQEHPDY
YLLLVCVQRLRVFISHYTLLFQCNEDLLIQKRKKLKKSSMAKLYKGLASQCANAGQDASP
TAGPEAVRDTGIHSEELLQPYPSAPSSGPAVTHLMPPVKKSQQQQSLMESMQPGKPSDWE
LDGRKHERPESLLAPTQFCAAEQDVKALAGPLQAIPEMDFEPSPAEPLGNVERSLRAPAE
LMPDARGFVPAAYEEFEYGGEIFALPAPYDEEPFQAPALFENCSPASSESSLDICFRPVS
FAMEAERPEHPLQPLPKSATSPAGSSSAYKLEAAAQAHGKAKPLSRSLKEFPRAPPADGV
APRLYSTRSSSGGRAPIKAERAAQPHGPAAAAVAARGAPRTFFPQQRSQSEKQTYLEVRR
EMHLEDTTRFCPKEERESEQTSFSDQNPRQDQKGGFRSSFRKLFKKKSSGSEYREKTNEN
PSMDPSPTKQDFFRNRLALANDLDQGTAV
Download sequence
Identical sequences G1S363
ENSNLEP00000019949 ENSNLEP00000019949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]