SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020052 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020052
Domain Number 1 Region: 61-241
Classification Level Classification E-value
Superfamily RNI-like 1.79e-26
Family Cyclin A/CDK2-associated p19, Skp2 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020052   Gene: ENSNLEG00000016525   Transcript: ENSNLET00000021058
Sequence length 258
Comment pep:novel supercontig:Nleu1.0:GL397422.1:655757:715159:-1 gene:ENSNLEG00000016525 transcript:ENSNLET00000021058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRPRRVSQLLDLCLWCFMKNISRYLTDIKPLPPNIKDRLIKIMSMQGRITDSNISEILH
PEVQTLDLRSCDVSDAALLHLSNCRKLRKLNLNSSKGNRVSVTSEGIKAVASSCSYLHEA
SLKRCCNLTDEGVVALALNCQLLKIIDLGGCLSITDVSLHALGKNCPFLQCVDFSATQVS
DSGVIALVSGPCAKILEEIHMGHCVNLTDGAVEAVLTYCPQIRILLFHGCPLITDHSREV
LEQLVGPNKLKQVTWTVY
Download sequence
Identical sequences G1S3G4
ENSNLEP00000020052 ENSNLEP00000020052 XP_003277846.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]