SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020053 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020053
Domain Number 1 Region: 154-358
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.07e-55
Family DBL homology domain (DH-domain) 0.00024
Further Details:      
 
Domain Number 2 Region: 342-474
Classification Level Classification E-value
Superfamily PH domain-like 2.39e-31
Family Pleckstrin-homology domain (PH domain) 0.003
Further Details:      
 
Domain Number 3 Region: 452-493,531-594
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.55e-22
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0025
Further Details:      
 
Domain Number 4 Region: 642-702
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000617
Family Pleckstrin-homology domain (PH domain) 0.0000586
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020053   Gene: ENSNLEG00000016521   Transcript: ENSNLET00000021059
Sequence length 725
Comment pep:novel supercontig:Nleu1.0:GL397279.1:784113:862167:1 gene:ENSNLEG00000016521 transcript:ENSNLET00000021059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESSGGSSTPPGPIAALRMPDTGPGSSSLGKLQALPVGPRAHCGDPGSPAAAGDRSLDTG
PTGELSGSLKIPNRDSGIDSPSSSVAGENFPCEEGLEAGPSPTVLGAHTEMALDSQVPKV
TPHEEADSDVGEEPDPENTPQKTDEDAGLAQHSGPQKLLHIAQELLHTEETYVKRLHLLD
QVFCTGLTDAGIPPEVIMGIFSNISSIHRFHGQFLLPELKTRITEEWDTNPRLGDILQKL
APFLKMYGEYVKNFDRAVGLVSTWTQRSPLFKDVIHSIQKQEVCGNLTLQHHMLEPVQRV
PRYELLLKDYLKRLPQDAPDRKDAERSLELISTAANHSNAAIRKVEKMHKLLEVYEQLGG
EEDIVNPANELIKEGQIQKLSAKNGTAQDRHLFLFNSMILYCVPKLRLMGQKFSVREKMD
ISGLQVQDIVKPNTAHTFIIMGRKRSLELQTRTEEEKKEWIQIIQATIEKHKQNSETFKA
FGGAFSQDEDPSLSPDVPITSTSPVEPVVTTEGGSGAAGLEPRKLSSKTRRDKEKQSCKS
CGETFNSITKRRHHCKLCGAVICGKCSEFKAENSRQSRVCRECFLTQPVAPESPSPEAPA
EPRQSTEVVGPPTNCPPVTKGSAGTATRPLGLSTALRCKGLGDGRLPCTIPLPSCKLSVP
DPEERLDSGHVWKLQWAKQSWYLSASSAELQQRWLETLSTAARGDTAQDSLGALQPQVPM
GTAAP
Download sequence
Identical sequences ENSNLEP00000020053 ENSNLEP00000020053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]