SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020169 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020169
Domain Number 1 Region: 657-899
Classification Level Classification E-value
Superfamily vWA-like 8.53e-77
Family Trunk domain of Sec23/24 0.00000566
Further Details:      
 
Domain Number 2 Region: 428-575,900-994
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 9.16e-74
Family beta-sandwich domain of Sec23/24 0.00048
Further Details:      
 
Domain Number 3 Region: 1100-1248
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 7.06e-34
Family C-terminal, gelsolin-like domain of Sec23/24 0.0019
Further Details:      
 
Domain Number 4 Region: 574-656
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 1.83e-23
Family Zn-finger domain of Sec23/24 0.00031
Further Details:      
 
Domain Number 5 Region: 997-1099
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 1.57e-18
Family Helical domain of Sec23/24 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020169   Gene: ENSNLEG00000016603   Transcript: ENSNLET00000021177
Sequence length 1249
Comment pep:novel supercontig:Nleu1.0:GL397323.1:6655696:6741028:-1 gene:ENSNLEG00000016603 transcript:ENSNLET00000021177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETGFLHVAQAGLKLLTSGTPGQLFSSIFGSTRPAQNQMQVPSGYGLHHQNYIAPSGHYSQ
GPGKMTSLPLDTQRGDYYSALYTVPTQNVTPNTLNQQPGAQQMYSRGPPAPHIVGSTLGS
FQGAASSASHLHTSASQPYSSFVNHYNSPAMYSANSSVASQGFPSTCGHYAMSTVSNATY
PSVSYPSLPAGDTYGQMFTSQNAPTVRPVKDNSFSGQNTAISHPSPLPPPPSQQHHQQQS
LSGYNTLTWSAPGLPSTQDNLIRNHTGSLAVANNPTITVADSLSCPVMQNVQPPKSSPVV
STVLSGSSSTRTPPTANHPVEPVTSVTQPSELLQQKGMQYGEYVNNQASSAPTPLSSTSD
DEEEEEEDEEAGVDSSSTTSSASPMPNSYDALEGGSYPDMLSSSASSPAPDPAPEPDPAS
APAPASAPAPVIPQPSKMAKPFGYGYPTLQPGYQNATAPLTSGVQPSNPVYSGFQQYPQY
PGVNQLCSSIGGLSLQSSPQPESLRPVNLTQERNILPMTPVWAPVPNLNADLKKLNCSPD
SFRCTLTNIPQTQALLNKAKLPLGLLLHPFRDLTQLPVITSNTIVRCRSCRTYINPFVSF
IDQRRWKCNLCYRVNDVPEEFMYNPLTRSYGEPHKRPEVQNSTVEFIASSDYMLRPPQPA
VYLFVLDVSHNAVEAGYLTILCQSLLENLDKLPGDSRTRIGFMTFDSTIHFYNLQEGLSQ
PQMLIVSDIDDVFLPTPDSLLVNLYESKELIKDLLNALPNMFTNTRETHSALGPALQAAF
KLMSPTGGRVSVFQTQLPSLGAGLLQSREDPNQRSSTKVVQHLGPATDFYKKLALDCSGQ
QTAVDLFLLSSQYSDLASLACMSKYSAGCIYYYPSFHYTHNPSQAEKLQKDLKRYLTRKI
GFEAVMRIRCTKGLSMHTFHGNFFVRSTDLLSLANINPDAGFAVQLSIEESLTDTSLVCF
QTALLYTSSKGERRIRVHTLCLPVVSSLADVYAGVDVQAAICLLANMEVNGKICISLISI
GATLNAVVDSLSAYGSTVSNLQHSALMAPSSLKLFPLYVLALLKQKAFRTGTSTRLDDRV
YAMCQIKSQPLVHLMKMIHPNLYRIDRLTDEGAVHVNDRVVPQPPLQKLSAEKLTREGAF
LMDCGSVFYIWVGKGCDNNFIEDVLGYPDFGSIPQKMTHLPELDTLSSERTRSFITWLRD
SRPLSPILHIVKDESPAKAEFFQHLIEDRTEAAFSYYEFLLHVQQQICK
Download sequence
Identical sequences ENSNLEP00000020169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]