SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020319 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020319
Domain Number 1 Region: 598-662,700-798
Classification Level Classification E-value
Superfamily PH domain-like 1.86e-30
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 2 Region: 1216-1349
Classification Level Classification E-value
Superfamily Second domain of FERM 1.7e-19
Family Second domain of FERM 0.0044
Further Details:      
 
Domain Number 3 Region: 805-922
Classification Level Classification E-value
Superfamily PH domain-like 7.61e-19
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000020319
Domain Number - Region: 1118-1197
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000233
Family First domain of FERM 0.074
Further Details:      
 
Domain Number - Region: 29-120,705-725
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000868
Family BAR domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020319   Gene: ENSNLEG00000016722   Transcript: ENSNLET00000021334
Sequence length 1493
Comment pep:novel supercontig:Nleu1.0:GL397288.1:23675721:23815981:1 gene:ENSNLEG00000016722 transcript:ENSNLET00000021334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELSEPEGPVDWKERCVALESQLMKFRVQASKIRELLAEKMQQLERQVIDAERQAEKAF
QQVQVMEDKLKAANIQTSESETRLYNKCQDLESLIQEKDDIIQNLELQLEEQKQIRIQEA
KIIEEKAAKIKEWVTVKLNELELENQNLRLIHQNQTEEIRTMQSKLQEVQGKKSSTVSTL
KLSEGQRLSSLTFGCFLSRARSPPQVVKSEEMSKISSKEPEFTEGKDMEEMEIPEKSVDN
QVLENHRGQRTLYQTPCGSEQNRKTRTSFATDGGVSQNSGAPVSDWSSDEEDGSKGRPKS
RCTSTLSSHTSEEGVQCSRMGSEMYLTASDDSSSIFEEETFGIKRPEHKKLYSWQQEAQW
KALNSPLGKGNSELSKKEQDSSSDELNKKFQSQRLDYSSSSSEANTPSPILTPALMPKHP
NSLSGKVTQLVPSSHLPPPKLRIPNVFSISVALAKRHFSQPQLSSDRMFGTNRNAISMIR
PLRPQETDLDLVDGDSTEVLENMDTSCDDGLFSYGSVDSPNSDDQENCDSAKKVACSKPP
TPPLHRFPSWESRIYAVAKSGIRMSEAFNMENVSKNSVATLSYTTSGLYTSLIYKNMTTP
VYTTLKGKATQISSSPFLDDSSGSEEEDSSRSSSRTSESDSRSRSGPGSPRAMKRGVSLS
SVASESDYAIPPDAYSTDTEYSQPEQKLPKTCSSSSDNGKNEPLEKSGYLLKMSGKVKSW
KRRWFVLKGGELLYYKSPSDVIRKPQGHIELSASCGILRGDNKQTVQLTTEKHTYYLTAD
SPNILEEWIKVLQNVLRVQAANPLSLQPEGKPTVKGLLTKVKHGYSKRVWCTLIGKTLYY
FRSQEDKFPLGQIKVWEAKVEEVDRSCDSDEDYEASGRSLLSTHYTIVIHPKDQGPTYLL
IGSKHEKDTWLYHLTVAAGSNNVNVGSEFEQLVCKLLNIDGEPSSQIWRHPTLCHSKEGI
ISPLTTLPSEALQTEAIKLFKTCQLFINAAVDSPAIDYHISLAQSALQICLTHPELQNEI
CCQLIKQTRRRQPQNQPGPLQGWQLLALCVGLFLPHHPFLWLLRLHLKRNADSRTEFGKY
AIYCQRCVERTQQNGDREARPSRMEILSTLLRNPYHHSLPFSIPVHFMNGIYQVVGFDAS
TTVEEFLNTLNQDTGMRKPAQSGFALFTDDPSGRDLEHCLQGNIKICDIISKWEQASKEQ
QPGKCEGTRTVRLTYKNRLYFSVQARGETDREKLLLMYQTNDQIINGLFPLNKDLALEMA
ALLAQVEIGDFERPFSTPAGHVTNQCKANQTLKQVIEKFYPKRYRDGCSEEQLRQLCQRL
STRWMALRGHSAADCVRIYLTVARKWPFFGAKLFLAKPITPSSLGSTFMWLAVHEDGLSL
LEYNSMRLIVSYVYKSLMTFGGYQDDFMVVINNTHSKDKPTEKLLFAMAKPKILEITLLI
ASYINNFHQQKAAFHHLSAPALLSAQTQGPQARMMGSQPLLSNSRPTKGPTLL
Download sequence
Identical sequences G1S481
ENSNLEP00000020319 XP_003262836.1.23891 ENSNLEP00000020319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]