SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020340 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020340
Domain Number 1 Region: 41-793
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.5e-254
Family Motor proteins 0.00000000055
Further Details:      
 
Domain Number 2 Region: 1251-1353
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.48e-18
Family First domain of FERM 0.033
Further Details:      
 
Domain Number 3 Region: 2117-2200
Classification Level Classification E-value
Superfamily PH domain-like 6.42e-18
Family Third domain of FERM 0.021
Further Details:      
 
Domain Number 4 Region: 1893-2001
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000142
Family First domain of FERM 0.088
Further Details:      
 
Domain Number 5 Region: 1345-1439
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000000379
Family Second domain of FERM 0.0076
Further Details:      
 
Domain Number 6 Region: 1993-2086
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000055
Family Second domain of FERM 0.0079
Further Details:      
 
Domain Number 7 Region: 1604-1674
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000107
Family SH3-domain 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000020340
Domain Number - Region: 795-863
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000149
Family Motor proteins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020340   Gene: ENSNLEG00000016747   Transcript: ENSNLET00000021356
Sequence length 2214
Comment pep:novel supercontig:Nleu1.0:GL397264.1:13032076:13124417:-1 gene:ENSNLEG00000016747 transcript:ENSNLET00000021356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVILQQGDYVWMDLRSGQEFDVPIGAVVKLCDSGQIQVVDDEGNEHWISPQNATHIKPMH
PTSVHGVQDMIRLGDLNEAGILRNLLIRYRDHLIYAPSGPALPTPPHPARLASLPPETLS
AVQLGPGAPAGAHLPAAARRGAHPLGPGFRDQCCIISGESGAGKTESTKLILQFLAAISG
QHSWIEQQVLEATPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEKS
RVCRQAPDERNYHVFYCMLEGMSEDQKKKLGLGQASNYNYLAMGNCITCEGRVDSQEYAN
IRSAMKVLMFTDTENWEISKLLAAILHLGNLQYEARTFENLDACEVLFSPSLATAASLLE
VNPPDLMSCLTSRTLITRGETVSTPLSREQALDVRDAFVKGIYGRLFVWIVDKINAAIYK
PPSQDVKNSRRSIGLLDIFGFENFAVNSFEQLCINFANEHLQQFFVQHVFKLEQEEYDLE
SIDWLHIEFTDNQDALDMIANKPMNIISLIDEESKFPKGTDTTMLHKLNSQHKLNANYIP
PKNNHETQFGINHFAGIVYYETQGFLEKNRDTLHGDIIQLVHSSRNKFIKQIFQADVAMG
AETRKRSPTLSSQFKRSLELLMRTLGACQPFFVRCIKPNEFKKPMLFDRHLCVRQLRYSG
MMETIRIRRAGYPIRYSFVEFVERYRVLLPGVKPAYKQGDLRGTCQRMAEAVLGTHDDWQ
IGKTKIFLKDHHDMLLEVERDKAITDRVILLQKVIRGFKDRSNFLKLKNAATLIQRHWRG
HNCRKNYGLMRLGFLRLQALHRSRKLHQQYRLARQRIIQFQARCRAYLVRKAFRHRLWAV
LTVQAYARGMIARRLHQRLRAEYLRRLEAEKMRLAEEEKLRKEMSAKKAKEEAERKHQER
LAQLAREDAERELKEKEAARRKKELLEQMERARHEPVNHSDMVDKMFGFLGTSGGLPGQE
GQAPSGFEGLQRPTHTACDEGGGVSSPLPKPPALAMSSTLASDLCALASDMCTLASDMRT
LASDMRTLASDMHSAAALAVWITILRFMGDLPEPKYHTAMSDGSEKIPVMTKIYETLGKK
TYKRELQALQGEGEAQLPDGQKKSSVRHKLVHLTLKKKSKLTEEVTKRLHDGESTVQGNS
MLEDRPTSNLEKLHFIIGNGILRPALRDEIYCQISKQLTHNPSKSSYARGWILVSLCVGC
FAPSEKFVKYLRNFIHGGPPGYAPYCEERLRRTFVNGTRTQPPSWLELQATKSKKPIMLP
VTFMDGTTKTLLTDSATTAKELCNALADKISLKDRFGFSLYIALDKVSSLGSGSDHVMDA
ISQCEQYAKEQGAQERNAPWRLFFRKEVFTPWHSPSEDNVATNLIYQQVVRGVKFGEYRC
EKEDDLAELASQQYFVDYGSEMILERLLNLVPTYIPDREITPLKTLEKWAQLAIAAHKKG
IYAQRRTDAQKVKEDVVNYARFKWPLLFSRFYEAYKFSAPALLPIYDVIVAVNWTGVYFV
DEQEQVLLELSFPEIMAVSSSRECRVWLSLGCSDIGCAAPHSGCAGLTPAGPCSPCWSCR
GAKTTAPSFTLATIKGDEYTFTSSNAEDVRDLVVTFLEGLRKRFKYVALQDNPNPAGEES
GFLSFVKGDLIILDHDTGEQVMNSGWANGINERTKQRGDFPTDCVYVMPTVTMPPREIVA
LVTMTPDQRQDVVRLLQLRTAEPEMRAKPYTLEEFSYDYFRPPPKHTLSRVMVSKARGKD
RLWSHTREPLKQALLKKLLGSEELSQEACLAFNDIPLKYMGDYPSKRTRSVNELTDQIFE
GPLKAEPLKDEAYVQILKQLTDNHIRYSEERGWELLWLCTGLFPPSNILLPHVQRFLQSR
KHCPLAIDCLQRLQKALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDEAFEVESS
TKAKDFCQNIATRLLLKSSEGFSLFVKIADKVISVPENDFFFDFVRHLTDWIKKARPIKD
GIVPSLTYQVFFMKKLWTTTVPGKDPMADSIFHYYQELPKYLRGYHKCTREEVLQLGALI
YRVKFEEDKSYFPSIPKLLRELVPQDLIRQVSPDDWKRDSVATWQSFALREVESPLAEIW
GEPFTAPRSAVLGLALRQTTEPNFPEILLIAINKYGVSLIDPKTKDILTTHPFTKISNWS
SGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTAMSKQRGSRSGK
Download sequence
Identical sequences ENSNLEP00000020340 ENSNLEP00000020340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]