SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020475 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020475
Domain Number 1 Region: 33-256
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.7e-57
Family Ankyrin repeat 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020475   Gene: ENSNLEG00000016858   Transcript: ENSNLET00000021492
Sequence length 264
Comment pep:novel supercontig:Nleu1.0:GL397279.1:4813061:4862228:-1 gene:ENSNLEG00000016858 transcript:ENSNLET00000021492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKLFSFGRRLGPALLSSMDQEYTGRGYHIADWELRKIHRAAIKGDAAEVERCLTRRFRD
LDARDRKDRTLLHLACAHGHVEVVTLLLGRRCQIDVCDRLSRTPLMKAIHCQEEACAIIL
LEHDASPNIKDIYGNTAVHYAVYNTGTSLAEKLLSHRANIEALKKEGNTPLLFAINSGRQ
HMVEFLLKNQANVHAVDNFRRTALMLAVQHSSSNIISLLLQQNINIFSQDMFGQTAEDYA
VCCDLRSIQQQILEHKNKILKNHL
Download sequence
Identical sequences ENSNLEP00000020475 ENSNLEP00000020475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]