SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020476 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020476
Domain Number 1 Region: 56-459
Classification Level Classification E-value
Superfamily Ras GEF 1.16e-90
Family Ras GEF 0.0011
Further Details:      
 
Domain Number 2 Region: 527-591
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.54e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.002
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000020476
Domain Number - Region: 466-498
Classification Level Classification E-value
Superfamily EF-hand 0.0018
Family Calmodulin-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020476   Gene: ENSNLEG00000016855   Transcript: ENSNLET00000021493
Sequence length 673
Comment pep:novel supercontig:Nleu1.0:GL397261.1:46287801:46306721:1 gene:ENSNLEG00000016855 transcript:ENSNLET00000021493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRKDSKRKSHQECTGKTGGRGRPHQVRRHKTCPSPGEISKVMASMNLGLLSEGGCSEDE
LLEKCIQSFDSTGSLCCGDHMLNMVLAMHSWVLPSADLAARLLTSYQKATEDTQELRQLQ
ICHLVRYWLTQHPEVMHQDPQLEEVIGRFWATVAQEGNSAQRRLGDSSNLLSPGGPGPPL
PMSSPGLGKKRKVSLLFDHLETGELAQHLTYLEFRSFQAITPQDLRSYVLQGSVRGCPAL
EGSVALSNSVSRWVQVMVLSRPGPLQRAQVLDKFIHVAQRLCQLQNFNTLMAVTGGLCHS
AISRLKDSHAHLSPDSTKALLELTELLASHNNYACYRRTWAGCTGFRLPVLGVHLKDLVS
LHEAQPDRLPDGRLHLPKLNNLYLRLQELVALQGQHPPCSANEDLLHLLTLSLDLFYTED
EIYELSYAREPRCPKSLPPSPFNAPLVVEWAPAVTPKPDRVTLGRHVEQLVESVFKNYDP
EGRGTISQEDFERLSGNFPFACHGLHPPPRQGRGSFSREELTGYLLRASAICSKLGLAFL
HTFHEVTFRKPTFCDSCSGFLWGVTKQGYRCRECGLCCHKHCRDQVKVECKKRPGAKGDA
GPPGAPVPSTPAPHASCGSEENPSYTLSLEPETGCQLRHAWTQTESPHTSWETDTVPCPV
MDPPSTASSKLDS
Download sequence
Identical sequences G1S4N8
ENSNLEP00000020476 XP_003252705.1.23891 ENSNLEP00000020476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]