SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020526 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020526
Domain Number 1 Region: 179-344
Classification Level Classification E-value
Superfamily RNI-like 1.31e-44
Family 28-residue LRR 0.000000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020526   Gene: ENSNLEG00000016899   Transcript: ENSNLET00000021547
Sequence length 359
Comment pep:novel supercontig:Nleu1.0:GL397279.1:5107134:5201407:1 gene:ENSNLEG00000016899 transcript:ENSNLET00000021547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYRRELEKYRDLDEDEILGALTEEELRTLENELDELDPDNALLPAGLRQKDQTTKAPTG
PFKREELLDHLEKQAKEFKDREDLVPYTGEKRGKVWVPKQKPLDPVLESVTLEPELEEAL
ANASDAELCDIAAILGMHTLMSNQQYYQALSSSSIMNKEGLNSVIKPTQYKPVPDEEPNS
TDVEETLERIKNNDPKLEEVNLNNIRNIPIPTLKAYAEALKENSYVKKFSIVGTRSNDPV
AYALAEMLKENKVLKTLNVESNFISGAGILRLVEALPYNTSLVELKIDNQSQPLGNKVEM
EIVSMLEKNATLLKFGYHFTQQGPRLRASNAMMNNNDLVRKRRLADLTGPIIPKCRSGV
Download sequence
Identical sequences G1S4T8 H2PSU3
XP_003260587.1.23891 XP_003260588.1.23891 XP_003820662.1.60992 XP_009242953.1.23681 9600.ENSPPYP00000021766 ENSPPYP00000021766 ENSNLEP00000020526 ENSNLEP00000020526 ENSNLEP00000023422 ENSPPYP00000021766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]